KEGG   Nostoc punctiforme: Npun_R1074Help
Entry
Npun_R1074        CDS       T00713                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
npu  Nostoc punctiforme
Pathway
npu00521  Streptomycin biosynthesis
npu00523  Polyketide sugar unit biosynthesis
npu01130  Biosynthesis of antibiotics
Module
npu_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Npun_R1074
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Npun_R1074
Enzymes [BR:npu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Npun_R1074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACC79800
JGI: NpR1074
CyanoBase: Npun_R1074
CYORF: Npun_R1074
UniProt: B2IVC4
Position
complement(1285836..1286390)
Genome map
AA seq 184 aa AA seqDB search
MIFTETVLKDAFIIDLEEKPDHRGFFARSFCAQEFEAHGLKPTVAQCNLSFNYKKGTIRG
MHYQILPAAETKLIRCTKGAIYDVIIDMRPESPSFLSHIGVELTPENRRALYVPEMFAHG
YQALTDETEVVYQVGEFYTPGYERGLRYDDPFFAIDWPLDVTEISEKDLNWPLLRMMTVG
GTSR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgattttcactgaaaccgtactcaaagacgcattcattattgatttagaagaaaaacca
gaccaccgtggtttttttgctcggtctttctgcgctcaagaatttgaagcacacggatta
aagccaacagttgcccaatgcaacctatcttttaactacaaaaaaggcactatccgggga
atgcactatcaaattctgccagcagcagaaacgaaattaattcgctgtactaaaggcgct
atctatgacgtaattattgatatgcgccctgaatctcctagctttttatcccatattggt
gtggaattaacaccagaaaaccgccgcgctttgtatgttccagaaatgtttgctcacggc
tatcaagcactcacagatgagactgaagttgtatatcaagtaggcgaattttacacgcca
gggtatgagagaggtttacgctatgatgacccattctttgccattgattggcctctagat
gtgactgaaatatctgagaaagatttaaattggcctttgttaagaatgatgacagttggc
ggtacttctagataa

DBGET integrated database retrieval system