KEGG   Nostoc punctiforme: Npun_R1544Help
Entry
Npun_R1544        CDS       T00713                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
npu  Nostoc punctiforme
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Npun_R1544
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Npun_R1544
Enzymes [BR:npu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Npun_R1544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1899431..1901836)
Genome map
AA seq 801 aa AA seqDB search
MTNQLSPKIPSCTWSRPIGLGWDKPYTVRYASNIDDGPWHGMPLGGFGAGCIGRSSRGDF
NLWHIDGGEHTFKNVPACQFSVFESNGTSTQAYALSTQGPNDGALKAWQWYPTLPSTEGT
GNYHALYPRSWFVYENIFQAQLTCEQFSPVWAGNYQETSYPVAIFLWNAHNPTNAPITLS
IMLTWQNMVGWFTNALKSPEVRVRDDGSPVYEYQPRWGESQGNYNQIVENPQQFGCLLSR
VGSDALQEGDGTWCIATLKHPQVEIFYHTRWNAEGTGDEVWQSFAKDGSLSNYIDANPVG
EGEQLGAAMALRFTLQPGETLEIPFVLAWDLPITEFAAGVNYYRRYTDFFDRSGNNAWAI
ASTALQEYQTWRSQIQTWQQPILDREDLPNWFKMALFNELYDLTSGGTLWSAASELDPIG
QFAVLECLDYRWYESLDVRLYGSFALLMLFPELEKSVMRAFARAIPQGDDTPRIIGYYMT
IKAESPIAVRKVAGATPHDLGAPNEHVWEKTNYTSYQDCNLWKDLGSDFVLQVYRDFLLT
GADDVEFLADCWNAIVQTLDYLKTFDLDGDGIPENSGAPDQTFDDWRLQGVSAYCGGLWL
AALEAAIAISDLLLTHKLGDLGGLAVQKSIYETWLQQSLPIYQEKLWNGQYYQLDSQSGS
DVVMADQLCGQFYARLLDLPDIVPSDRALSALKTVYDACFLKFCNGEFGTANGVRPDGSP
ENPKATHPLEVWTGINFGLAAFLVQMGMKDEALRLTQAVVQQIYENGLQFRTPEAITAAG
TFRASTYLRAMAIWGIYLVIN
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaactctctccgaaaattccctcttgtacttggagccgtcccatcggttta
ggctgggacaaaccttatactgtccgctacgcaagtaatatcgatgatggtccttggcat
ggtatgcctttaggtggctttggtgcaggttgcatcggtcgttcttcacggggagatttt
aacctgtggcacatcgacggcggtgagcataccttcaaaaacgtccccgcttgtcaattc
agtgtatttgaatccaatggcacatctacccaagcctacgctttatctacccaagggccc
aatgatggcgctctcaaagcttggcagtggtatccaacgcttcccagtacagaggggacg
ggtaattatcacgcgttatacccacgtagctggtttgtgtatgaaaatatattccaagca
cagttgacttgtgagcaattttccccagtttgggcaggtaattatcaagaaactagctac
cctgtagcaatattcctctggaatgcccacaaccccacaaatgcaccaattactctcagc
attatgctcacttggcaaaatatggtgggctggtttacaaatgccctcaaatctcccgaa
gtgcgggtgcgtgatgatggtagtccggtttacgaataccaaccgcgctggggcgaaagt
caaggaaactataaccaaatagttgaaaatccacaacagtttggctgtcttttaagtcgg
gttggtagtgatgctttgcaagaaggagatggaacttggtgtattgcaacattgaaacat
ccccaagtagaaatattttaccacactcgctggaatgctgaaggaactggtgatgaggtg
tggcaaagttttgcgaaagatggttctttgtccaattatatagatgctaatccagtcgga
gaaggtgaacagttaggagctgcgatggcactccgttttactctccaaccaggcgaaacc
ctcgaaatcccctttgtcctcgcttgggatttgcctatcacggaatttgccgccggagtc
aactattatcgcagatatacagacttttttgatagaagtggaaataatgcttgggcgatc
gcatctactgccctacaagaataccaaacctggcgatcgcaaattcaaacttggcaacaa
cccattcttgaccgggaagatttgcccaactggtttaaaatggctctatttaatgagctt
tacgacctcactagcggcggtactctctggagtgcagcatcagaacttgaccccatcggt
cagttcgcggtgctggagtgtctagattatcgatggtatgaaagtctagatgtgcgatta
tatggctctttcgccctactaatgctgtttccagaattagaaaagtcggtgatgcgggca
tttgcacgggcgattcctcaaggtgatgatacaccccgaataatcggctattacatgact
atcaaagctgaaagcccaattgcagttcgcaaagttgcaggtgcaacaccccacgattta
ggcgcaccaaatgaacacgtatgggagaaaactaattacaccagctatcaagactgcaat
ttatggaaagatttaggtagtgattttgtcttgcaagtataccgggattttctgctcacg
ggtgctgacgatgtagaatttctagcagattgttggaatgcgatcgttcaaactctagac
tacttgaaaacctttgaccttgatggtgatgggattcctgaaaattctggtgcgcctgac
caaacctttgatgattggcggttacagggtgtcagtgcttattgtggtggattgtggtta
gcggcgctagaggctgcgatcgcaattagcgatcttttattaactcacaaacttggcgac
cttggcggcttggcggttcaaaaatccatctatgaaacttggttacaacaatctcttcct
atttaccaagaaaaactctggaatgggcaatattaccaacttgatagtcaaagtggttcc
gatgtggtaatggcggatcagttgtgcggacaattctacgcccgactattggacttacca
gatattgtaccgagcgatcgcgccctttctgccctgaaaactgtttatgatgcgtgcttt
ttgaaattctgcaatggagagtttggtactgcgaatggtgttcgtcctgatggttcacca
gaaaaccctaaagctactcatcccctagaagtttggactgggataaactttgggctagcg
gcttttcttgtgcaaatgggaatgaaagatgaagcgttgaggttaacacaggctgtagta
cagcagatttatgaaaatgggctgcaatttcgcacccctgaagctatcaccgcagctggt
acttttcgcgctagcacctacttacgggcaatggcaatctggggaatttacttagttatt
aattga

DBGET integrated database retrieval system