KEGG   Nostoc punctiforme: Npun_R1564Help
Entry
Npun_R1564        CDS       T00713                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
npu  Nostoc punctiforme
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Npun_R1564
Enzymes [BR:npu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Npun_R1564
Exosome [BR:npu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Npun_R1564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1931251..1932765)
Genome map
AA seq 504 aa AA seqDB search
MHTFGNTTPSSGYILSLDLGTTGNRAFVFNADGKIVGQAYKELTQYYPQPGWLEHDAQQI
WQDTCWVIETAIENARIAPSTIAALGLTVQRETCLIWDKTTGRPLHRAIVWQDRRTAPLC
HQLQEQGYADEIYDRTGLIIDAYFSATKLRWLLDKFTDVNLNNVLAGTIDTWVLWNLTGG
KVHATDHSNASRTMLMNLKTCEWDDNLLNLFQIPAHILPKIQPSLGVFGVTDATLLGAEI
PITAILGDQQAALFGHGCDRPGLMKCTYGTGSFLVAHTGNRIVRSHHQLISTVAWTQANP
RGALDVGYALEGSMFTSGACIQWLRDRLKLIKTAAESETMANQVTDNGGVYFVPAFSGLG
APYWDMSARGAFFGITASVQPEHLVRAVLEAIAYQVVEVVQAINSSSSTPVGRLTVDGGA
CENNFLMQFQADVLGIPVERPIMRDTTVQGAAFAAGLAIEFWESYEALVQQRQIERVFEP
RSDKPLSNFDTWQKAVKRTLAWEE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcacacatttggcaacacaactccatcatcgggttacatcttatcactggacttaggt
acgacaggcaaccgcgcctttgtgtttaacgcagacggcaagattgttgggcaggcatac
aaagaactaactcagtattatcctcaacctggatggttagaacacgatgctcaacaaatc
tggcaagatacgtgttgggtgatagaaaccgcaattgaaaatgcccgcattgctccatca
acgatcgcagcattgggactaactgtacagcgtgaaacctgcttgatttgggacaaaact
actggtagaccactccatagagcgatcgtttggcaagatcgccgcactgctcccctttgt
caccagttacaagagcaaggctacgctgatgaaatttacgatcgcactggattaatcatt
gatgcctatttctctgctaccaaacttaggtggctattagataagtttacagacgttaac
ctaaacaatgtcttagctggcactattgatacctgggtgctgtggaatcttacaggtggg
aaagtccatgctactgaccacagcaacgccagccgaacaatgttgatgaatctcaaaacc
tgtgagtgggatgataatttactaaatttgtttcaaattccggctcatattttgcccaag
attcagcctagtttaggagtatttggagttactgatgctactttgttgggcgctgaaatt
ccgattactgcgatcttgggagatcaacaagcagctttatttggtcatggttgcgatcgc
cccggtttgatgaaatgtacttacggaactggtagctttttggtagctcacacaggcaat
cgaattgtgcgctcgcaccatcaacttatttctacggtggcatggacacaagcaaatcca
aggggagcattggatgtaggttatgccttagaaggtagtatgtttaccagtggagcttgt
attcaatggttgcgcgatcgcctcaagctgattaaaactgctgctgaaagtgaaacgatg
gcaaatcaggtgacagataatggcggagtctactttgtgcctgcatttagtggactgggg
gcaccctattgggatatgagtgctaggggagcctttttcggcattaccgccagtgtccaa
ccagagcatctagtacgcgccgtgttagaagcgatcgcgtatcaagttgtggaagtagta
caggcaattaattcatctagcagtactccagttggtcgattaaccgtagatggtggtgct
tgcgaaaataattttttgatgcaattccaggctgatgtattaggtattccagttgaacgt
ccgataatgcgcgatacgaccgttcagggtgcagcatttgcagcaggtttagctatagaa
ttttgggagagctacgaagcgctggtgcagcaacggcaaattgagcgtgtgtttgaaccg
aggagcgataagccattatctaactttgatacttggcaaaaagcagtgaaacgcactctg
gcttgggaggagtaa

DBGET integrated database retrieval system