KEGG   Nostoc punctiforme: Npun_R1857Help
Entry
Npun_R1857        CDS       T00713                                 

Definition
(GenBank) asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
npu  Nostoc punctiforme
Pathway
npu00250  Alanine, aspartate and glutamate metabolism
npu01100  Metabolic pathways
npu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Npun_R1857
Enzymes [BR:npu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Npun_R1857
Peptidases [BR:npu01002]
 Cysteine Peptidases
  Family C44
   Npun_R1857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC
Motif
Other DBs
NCBI-ProteinID: ACC80514
JGI: NpR1857
CyanoBase: Npun_R1857
CYORF: Npun_R1857
UniProt: B2J2T3
Position
complement(2282244..2283998)
Genome map
AA seq 584 aa AA seqDB search
MLFDAFKNRKSPKIEFIKTDPTWRVAWGTVDESYENIAWRDEKFYVVLPRTASGFLTEKL
AISSGGRFVVVGDVWLTNQVQLLQKLGIEPDSFQGSYLQVVANLWERWGFECLHQLVGMF
ALVVWDRERQVLKLVRDRIGVRTLYYTTTGSVRWIAPQLRTLSPHRSSELDLVALRDYLC
CAFVPGERTLWEQVRELRPGTVLEFPDQKIEAYWQLQEQIVAIDQPLAWHGDRLRELLDQ
VVQEYLPPANEPVGVFLSGGLDSSCITALAAKFHKAPVHTFSIHFGSECPNELEFSSLVA
SHCQTQHHILEITFKDMWSRLPETMAYLDDPIGDPLTVPNLLLGRLARENVEVVLNGEGG
DPCFGGPKNQPMLINSLYGSVTNQDALQAYLISFQKCAVDLPQLLKPEVWTAVQTAPWVF
EEDLYSQASYLNRLMAMNIKFKGADQILTKVSNLTQAALLHGRSPLFDQRVVDLSMEIPP
EYKLSGVEEKAVLKQVIADILPEEIIHRPKSGMMVPVQLGFRKYWQQEARDLLLNRNAAI
TPYLNQLPIRNWLNYQGDTWSRYGVKLWLLASLEIWLQVNQKVR
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgctatttgatgcgtttaaaaatcgtaaatctcctaaaatcgaatttattaagactgac
ccaacctggcgcgtagcttggggaacagttgatgaaagttatgaaaatatagcttggcga
gatgaaaaattttatgtagttttaccacgtacagcttctggatttctgacggagaaatta
gcaatcagttctggaggacgatttgttgttgttggtgatgtttggttaactaaccaagtg
cagttactgcaaaagttagggattgaaccggatagctttcaaggaagttatctgcaagta
gttgccaatctttgggaacgatggggttttgaatgtcttcaccaacttgtgggaatgttt
gcgctagtggtttgggatagagaaagacaagtattgaagttggttcgcgatcgcatcggt
gttcggactctctattacactaccactggttcggttcgttggattgcgcctcaactgaga
actttatcacctcaccgttcatccgaattagatttggtagcgttgcgagattacctttgt
tgtgcctttgttccaggagaaagaacgctttgggaacaggtgcgcgaactacgacctgga
accgttttagaatttcccgaccagaaaattgaagcttactggcagcttcaagaacagatt
gtagcaatagatcaacccttagcatggcatggcgatcgcttgcgagaactcctagaccaa
gttgttcaagaatatttaccaccagcaaacgaacccgtcggcgtttttctttctggtggt
ttggactctagctgtatcactgctttagcagcgaaattccacaaagcaccagttcacacc
ttctcgattcattttggttcagaatgtcccaatgagttagaattttccagtctcgttgca
tcccattgccagacgcagcaccacattttggaaattacttttaaggatatgtggtcacgt
ctgccagaaacaatggcgtatttagatgaccccattggcgacccactgactgttcccaac
ctcttgctgggacgactggcgagagaaaacgtagaagtagttttaaatggtgaaggtggc
gacccctgttttggtgggccaaaaaatcagccaatgctcatcaatagtttatatggctct
gtcactaatcaggatgcattgcaagcttatttaatttcctttcaaaagtgcgctgttgac
ttaccgcaacttttaaaaccagaagtttggacagcggtacaaacagcaccttgggttttt
gaagaagatttatattcccaagccagctatctgaatcgtttgatggcaatgaacatcaaa
ttcaaaggtgctgaccaaattctgacgaaagtcagtaacttgactcaagcagcccttttg
cacggacgttctcccctatttgaccaacgagtagtagatttaagcatggaaatccctcca
gagtataaactttctggggtggaagaaaaagcagttttaaagcaagttatcgcagatatc
ttaccagaggaaattattcatcgtcccaaaagtggcatgatggtgcctgtgcagttagga
tttcggaaatattggcagcaagaagctagagatttattactaaatcggaatgcagctatc
actccttacttgaaccagttaccaattcgtaattggttaaactatcaaggagatacttgg
agtcgttatggagtaaagctttggttgcttgcaagtttagaaatttggttacaggtgaat
caaaaagtgcggtag

DBGET integrated database retrieval system