KEGG   Nostoc punctiforme: Npun_R2028Help
Entry
Npun_R2028        CDS       T00713                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
npu  Nostoc punctiforme
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Npun_R2028
Enzymes [BR:npu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Npun_R2028
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Npun_R2028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2462836..2463390)
Genome map
AA seq 184 aa AA seqDB search
MANLLLDDGTIESDLGEIARELAPFGIQLRHYNPGTSLLFPNLLSQDVLTESEKHYCVEL
HNSVFEFLQQENGAIWCDLLNVHPGSFNLHHLIATYGRYHTHPAPEPLYVLAGEMIYGFV
RPDGSQVQLLVQAQDYLYIPADVEHWCSPTASLNFKAVRYFAIAEGWVPNYTGTQVSDSL
NKPG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggctaacctactacttgacgacggtacgattgagagcgatttaggcgaaatagctcgt
gaacttgcgccttttggcattcaactcagacactacaatccaggaacatcgctactcttc
cccaatctgttaagccaggacgttttaactgaatcggagaaacattattgtgtagaactc
cataacagcgtttttgaatttcttcagcaagaaaatggcgctatctggtgtgacttgtta
aatgtgcatccaggttcctttaatcttcaccatctaatagcaacctacggccgttaccat
actcatcctgcgcctgaacccctctacgtgttggcaggagaaatgatctatggcttcgtg
cggcctgatggcagtcaggtacagcttttagttcaggcacaagactatctttacatcccc
gctgacgttgagcattggtgcagtccaactgcatcgttgaatttcaaagcagtacgctat
tttgcgatcgcagagggttgggttcccaattatacaggtactcaagttagcgattcactc
aacaagccaggttaa

DBGET integrated database retrieval system