KEGG   Nostoc punctiforme: Npun_R2099Help
Entry
Npun_R2099        CDS       T00713                                 

Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
npu  Nostoc punctiforme
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Npun_R2099
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Npun_R2099
Enzymes [BR:npu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Npun_R2099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2569889..2571223)
Genome map
AA seq 444 aa AA seqDB search
MKSKIDTFVRTNTRKVKKWRQHFQQRKKTLKFLLQTFIMLCVGGMIIAMTMVKTSAMDDT
LIRKNVLDLTPREKADFVNAIKTLKQTIPQGSTISLYDQIVAVHVGAMGFSSMHTGGMNT
NQQNTIPHPTGPASGTDAAHGNAGFLPWHREYLRRFEKALQSVNPKITIPYWDWTDTRAI
DIIFKPDFLGTNGTGTTINVPGADTFLGGSVQFGNFSEADGWVLNKNLHIDQVTNETLGT
PLIRFLKVPPANNYPLPQTEINNLLNINDYLQFRPAIEGDISVDSNGNETPGVFTHNYLH
GLVGGIIVDLTQFPPPLLQRLGTMSNVPGSPNDPIFWLHHANVDRLWAQWQENHRPKKAF
YPKANQPYGHNLNDPMWPWDGGQSKPGKIGPGDILSLLPSFAPNDIVTPKDTLNLRKYGY
TYDTLRHVRKLPIWSFDSLIENKF
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctaaaattgacacttttgttcgtacaaacactagaaaagttaaaaagtggaga
caacatttccagcagagaaaaaaaaccttaaaatttctccttcaaacattcatcatgtta
tgtgttggcggcatgattattgccatgactatggtgaaaacttcagcaatggatgacacc
ctaatcagaaagaacgttcttgacctgactccacgagaaaaagcagactttgttaatgct
atcaagacattaaaacaaacaatccctcaaggcagcaccatcagcctctatgaccaaatt
gtggcagtacacgtaggagcgatgggattctcatcaatgcatacgggagggatgaataca
aatcagcaaaatacgatcccacatccaactgggccagcatctggaactgatgctgctcat
ggaaatgctggatttctcccctggcatcgtgaatatttaagacgatttgaaaaagcttta
cagtcagttaacccgaagataactatcccttattgggattggacagatactagagcgatc
gatattatctttaaacccgactttttagggacaaatggcacaggaacaacaattaacgtt
ccaggtgccgacacttttttggggggttctgttcaatttggtaatttttctgaagctgat
ggctgggttctgaacaaaaacttacatattgaccaagtgacaaacgaaactctgggaacg
ccactcatccgctttctcaaagtacctcctgccaataactaccccctacctcaaacagaa
ataaataatttgctcaatatcaatgactatcttcagtttcgccctgccatagaaggagat
atcagcgtcgattcaaacggtaatgaaactcctggagtattcactcataactatcttcat
ggattggtaggtggaattattgttgatttgactcagtttccgccccctttactgcaaaga
ttaggtactatgagtaacgttcctggttctcccaacgatcccattttctggctgcatcat
gccaacgtcgatcgcctttgggcccaatggcaagagaatcatcgccctaaaaaagctttt
tatccaaaagcgaatcagccttatggacacaatctcaacgatcctatgtggccttgggat
ggaggacagtccaaaccaggaaaaataggccctggggatatactatctctgctaccaagt
tttgcacccaatgacattgttacgcctaaagacactctcaatctgagaaagtatggctat
acctacgacactctgagacatgtgcgaaaacttccaatatggtcgtttgactcgttgatc
gagaataaattctaa

DBGET integrated database retrieval system