KEGG   Nostoc punctiforme: Npun_R2732Help
Entry
Npun_R2732        CDS       T00713                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
npu  Nostoc punctiforme
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Npun_R2732
Enzymes [BR:npu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Npun_R2732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(3388591..3389523)
Genome map
AA seq 310 aa AA seqDB search
MSIIVFGSINIDLVATTPRLPVPGETLLGEEFFKVSGGKGANQAVALAKLGIPTQMVGRV
GADDFGVELVNNLQSSGVQIDNIFVDETVSSGVAIIAVNHAGENQIIVIPGANGRVNQED
VERLSQLLPEATALLLQLEIPITTVIAAATAARKSKIRVILDPAPAQSNFPDELYPLVDI
ITPNEVEAAQLVGFPVDGEEQAAKAAEVLLQRGVKCAIVKLGAKGVFCATAEEKFFVPVF
PVHAVDTVAAGDAFNGGLTAALFAGFSLHQAVVWGAAAGALATTKSGAQTSLPDRFTFDA
FLREKASVRD
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagcattatcgtctttggcagcataaatatagacttggtagcaacaacaccccgattg
ccagtcccaggagaaacgttgctaggagaagaattttttaaagtttcgggaggtaaagga
gcgaatcaagctgtagcattagcaaaactgggaattcctacccaaatggtggggcgtgtc
ggtgcagacgattttggtgtggaacttgtcaacaatttgcaatcatctggtgtgcagatt
gataatatttttgtggatgaaactgttagttctggagttgctattatcgccgtaaatcat
gctggggaaaatcaaattattgtaattcctggtgcaaatgggcgtgtcaatcaagaagat
gtagaacgattgtcgcagttattaccagaagcgacagcactgcttttacaattagaaatt
ccaattactaccgtgattgcagctgctacagcagcaagaaaaagcaaaatcagggtaatt
ctcgatccagcacccgcacaatctaattttccagatgaactttatccattagtggacatt
attacacccaatgaagttgaagccgcgcagctagtgggttttcctgtggatggagaggaa
caagcggcaaaggctgctgaagttttattacaacggggtgtgaaatgtgcgattgttaaa
cttggtgctaaaggtgttttttgtgccactgctgaggaaaagttttttgtccccgtcttt
ccagttcatgcagttgacacagtagcagctggcgatgcttttaatggtggcttaacggcg
gcactttttgcaggattttctttacatcaagcagttgtttggggcgcagcagcaggtgct
ttagcgacgacaaaatcaggcgcacaaacttcactacccgataggtttacatttgatgcc
tttcttagggaaaaggcatctgtcagagattaa

DBGET integrated database retrieval system