KEGG   Nostoc punctiforme: Npun_R3102Help
Entry
Npun_R3102        CDS       T00713                                 

Definition
glycoside hydrolase 15-related (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
npu  Nostoc punctiforme
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Npun_R3102
Enzymes [BR:npu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Npun_R3102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(3858381..3860774)
Genome map
AA seq 797 aa AA seqDB search
MKILSQGQAFGSPGIDPQWTHANKDGVGTAYSTSSRVWFTVWNGVVTEIYHPTVDRPQVR
DLQYLISDGKSFFHEEKRHLESKVEPMWIHGLGYRITNSDPQGRYAVIKEVIADPHLSCI
LQHTKLTGDSDFISQLQLYALCAPHLEVGGRGNNGYAVQVAGHRILTAEKAGTWLALSAT
VPFTRLSCGYVGQSDGWTDLADNFRMDWEFDSAVDGNLALTGKLNLNGSKEFTLGLAFGT
TLHNAISTLFQSLNIPFEKQKQQYNEQWKRSRDGIHSLENASYDDGKLYHNSVSLLLAHE
DKSYPGALIASMAIPWGEAKDDQDQGGYHLVWTRDLVSSVTGLVAAGETDTAVRSLIYLA
TSQQEDGGFAQNFWVDGEPYWKGIQLDEVAFPILLAWILHQEKVPLHFDIYPMILRAAGY
LIRHGPATQQERWEENSGYSPSTLASNIAALICAAQFVRESGDEATAQFIEEYADFLESH
IEAWTVTTEGTLVPGIKRHYIRITPTNINNPQPNENPNQGTLLIASQPPGEPAEFPAKEI
VDGGFLQLVRYGIRKPDDPIIVDSVKVIDAILKVDTPVGPCWHRYNHDCYGQQEDGSPYI
GYGKGHAWPLLTGERGHYELAAGGDVKTYIKVVEGFASNTCLLPEQVWDEADRPDIHQYL
GKPTGSAMPLMWAHAEYIKLLRSNHDGQVFDFIPEVANRYLGERKQCKSLEIWKFNRQID
KVKKGYTLRIHALASFQLHWSDDNWQTVKDTPSTSTKLGVNFVDISVSDNQQQPIIFTFF
WIDTSKWEQRNYTVAVS
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcttagtcaaggacaggcttttggttcacctggcatcgatcctcaatggact
catgccaataaagatggagtaggaacagcttactctacctccagtcgcgtttggtttact
gtctggaacggtgttgtgactgaaatctaccaccccacagtagacagaccccaagttcgg
gatttacagtatctcatttctgatggtaaaagctttttccacgaagagaaacgccatctc
gaatcaaaagtagaaccgatgtggattcatggtttaggatatcgcatcactaattccgat
ccccaagggcgttatgctgtaatcaaagaagtgattgctgacccgcatttatcctgtatt
ttacaacatacaaagttaacaggagatagcgattttatttcccaactccagctatacgct
ttatgtgcgccgcatctggaagtcggaggtagaggtaataatggttacgctgtacaagtt
gctggacatcggattctaacggccgagaaagcaggaacatggctagcgctgagtgcaaca
gttccctttactcgtctttcctgtggctacgttggacaaagtgatggttggacagattta
gctgataattttcggatggattgggagtttgacagtgctgtagatggcaaccttgctttg
actggaaaattaaatctcaatggcagtaaagagtttactttagggctggcatttgggaca
actctgcacaatgcaatttccacactgtttcagtcactcaatattccttttgagaagcag
aagcagcaatataacgaacagtggaagcgatcgcgcgacggcatccactcattagaaaat
gcttcttatgatgatgggaagttgtatcacaacagcgttagtttgttgttggcacacgaa
gacaaaagctatcccggtgctttaattgcatctatggctatcccttggggtgaagccaaa
gacgaccaagaccaaggaggatatcaccttgtctggacgcgggatctggtcagtagtgta
acaggtttggtggctgctggggaaacagatacagcagtgcgatcgctaatttatcttgca
accagccagcaagaagatggtggttttgcccaaaatttctgggttgatggtgaaccttac
tggaaaggtattcagctagatgaagtggcatttccaattttactggcatggatattgcac
caagaaaaagtaccactgcactttgatatttatcccatgattttacgagcggcaggttat
ttaattcgtcatggccctgctacccaacaagaacgctgggaagaaaacagtggctattca
ccttctacactggcatctaatattgccgctttaatctgcgctgctcaatttgttcgtgaa
agtggtgatgaagcaacagcacaatttattgaagaatacgccgattttttagaatctcac
attgaagcttggacggttactaccgaaggaaccctggttcctggcatcaaacgccattac
atccgaattactcctacaaatatcaataatcctcaacccaacgaaaatcctaatcaggga
actcttcttattgccagtcagccacctggtgaaccagcagaatttccagcgaaggaaatt
gtcgatggcggattcttacaattagttcgctatggaattcgcaaaccagatgacccgatt
atcgttgattctgtcaaagtaattgatgcaatcttaaaagtagatacacccgttggccct
tgttggcatcgttacaaccacgactgctacggtcaacaagaagatggaagtccttacatt
ggttatggcaagggacacgcttggcctcttttgacaggagaacgaggacattatgaatta
gctgctggcggcgatgtcaaaacatatatcaaggtggtggaaggatttgcttcaaacact
tgtttgttaccagaacaggtttgggatgaagcagatagaccggatatccatcagtatttg
ggaaaaccaacaggttctgcgatgcctttaatgtgggcgcacgcagagtatatcaagctg
ctacggtcaaaccatgatggtcaggtgtttgattttattccagaggtagcgaatcgttat
ttaggcgaaagaaagcagtgtaaatcgttggaaatttggaagtttaaccgtcaaatagac
aaagttaaaaaaggttatacactacgaattcacgctttagcatcttttcaattacactgg
tctgatgataattggcaaactgtaaaagataccccttctacttctacaaagttaggagta
aattttgtagatatttctgtttctgataaccaacagcagccaattatctttacctttttc
tggattgacactagtaaatgggaacaacgcaattacacagttgcagtttcataa

DBGET integrated database retrieval system