KEGG   Nostoc punctiforme: Npun_R3716Help
Entry
Npun_R3716        CDS       T00713                                 

Definition
multi-sensor signal transduction histidine kinase
Orthology
K07769  
two-component system, OmpR family, sensor histidine kinase NblS [EC:2.7.13.3]
Organism
npu  Nostoc punctiforme
Pathway
Two-component system
Module
NblS-NblR (photosynthesis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:npu02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(4680590..4682536)
Genome map
AA seq 648 aa AA seqDB search
MLTLLKTIRHAIASWWSEFTLQTKLLAVATLVVSLVMSGLTFWAVNTIQQDARMNDTRFG
RDLGLLLAANVAPLVADNNLTEVAQFSQRFYSSTSSVRYMLYADETGEIFFGIPFWEAEV
ENSLTIKRRIQLPEDYPGDGEKPMVRQHMTPDGVVTDVFIPLIVNKKYLGVLAIGINPNQ
TAVISTNFTRDVTIAVFITIWVMVILAGVINALTITKPIKELLVGVKEIATGNFKQRIDL
PLGGELGELILSFNEMAERLERYEEQNIEELTAEKAKLETLVSTIADGAVLIDNNMQVIL
VNPTARRIFGWETADVVGCNVLHHLPPAVQMEITGPLYEMAAGECESAEFRIFINQPTPR
TIRILLTTVLNVQRESIKGIAITVQDITREVELNDAKSQFISNVSHELRTPLFNIKTYIE
TLHDYGEDLGLEERQEFLQTVNHETDRLTRLVNDVLDLSKLESGRQYNFDGVDLAQAIEQ
TLRTYQLNAKDKGVELLQEVDTNLPLVMGNYDLLVQVFGNLIGNALKFTKAGGKVAIRAY
QLDFKPNHSQSSPVRIEISDTGIGIATEDQHSIFERFFRVENRVHTLEGTGLGLSIVRNI
IDRHRSKVHLVSEVGIGTTFWFDLAAFEEKAPPIQVEAITEASKITTV
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgctaactctgttaaaaacaattcgacatgcgatcgcaagttggtggtctgagttcacc
ctccagactaagctgctggctgtggctacattggtggtttccttggtgatgagtggtttg
accttctgggctgtgaatacaattcagcaggacgcgcggatgaatgacacccgcttcggg
cgtgacttgggtttgctgcttgctgccaatgttgcccccctggttgctgacaataatctc
acggaggttgcccaattttctcaacgcttctacagcagcacctctagcgtgcgttatatg
ctttacgctgatgaaaccggggaaatcttctttggcatacctttttgggaagccgaggta
gaaaattccctcaccattaaacggcgaatacaattgccagaagattaccctggtgatggg
gaaaagccgatggtgcggcaacacatgactccagatggagttgttaccgatgtatttatt
cctctgatcgttaataagaaatacttaggtgtattagcgatcggtatcaaccccaatcag
actgctgtcatctccaccaattttacccgcgatgtcaccattgccgtttttatcacaatt
tgggtaatggtgattttggcaggagtaatcaacgctttgaccatcactaaaccaataaaa
gaactgctagtgggggtaaaggaaattgctaccgggaatttcaagcagcgcattgattta
cctttagggggcgaactaggggagttaattttaagctttaatgagatggcagagcgatta
gaacgctatgaagaacagaatattgaagaactgaccgcagaaaaagccaagctagaaacc
cttgtttccacgatcgcagatggtgctgtgttgattgataacaacatgcaggtgatatta
gtcaaccccacggcgcggcggatttttggctgggaaacggctgatgtggttggttgcaat
gtattgcatcacttgccgccagcagtacaaatggaaatcactggcccattgtacgaaatg
gcagcaggtgaatgcgaaagcgccgaattccgcatttttattaaccaacccacccctcga
acaatccgtattctcttgactacagtactcaacgtgcaaagagaaagcatcaaaggtatt
gcgattaccgtccaagatataacccgtgaggtggaattaaacgatgcaaaaagtcaattt
atcagcaacgtttctcacgaactgcgaacgcctttatttaacatcaaaacctatattgaa
accctgcatgactacggcgaagacttaggattagaagaacggcaagagtttttgcaaaca
gttaatcatgaaaccgatcgcctaacccgcctagttaacgatgtattagatttatcaaaa
ctcgaatctggccgtcagtataacttcgatggagtggatctagctcaagcgatcgagcaa
acattgcgtacttaccaactcaatgccaaagataaaggtgttgaacttcttcaggaagtt
gatactaatttacccctggtaatgggtaattacgatctgttagtacaagtttttggcaat
ctaattggtaatgccctcaaatttaccaaagccggtggtaaagtagcaatccgcgcttac
caactagatttcaaacccaatcacagccaatcttctccagtgcggattgaaatttccgat
actggaattggcattgctacagaagaccagcactcaatttttgaacgcttctttcgcgta
gaaaaccgagttcacaccctagaaggcacaggtttaggattatcgattgtcagaaatatc
atcgacagacatcgtagtaaagtccatctagtgagtgaagttggcattggcacaactttt
tggttcgacttagccgcctttgaggaaaaagcgccaccgatacaagttgaagctattact
gaagcatccaaaatcaccacggtctaa

DBGET integrated database retrieval system