KEGG   Nostoc punctiforme: Npun_R3764Help
Entry
Npun_R3764        CDS       T00713                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
npu  Nostoc punctiforme
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:npu00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:npu00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:npu02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(4747370..4748971)
Genome map
AA seq 533 aa AA seqDB search
MESHNQLRLNRRQFLLRSAITAGGIISTNFVSKSKVFAEAPAIITSDKMRPAIPYGVASG
DISNESIVIWSRSDRPAKMLVEYSTSESFRNVQRVVGPNALQNSDFTARLYLRNLPPDQQ
LFYRVIFQDLDYKGTYSAPVKGTFRTPPKSRRDIFFVWGGDTAGQGWGINPDFGGMKIYE
TMRQLNPDFFIHSGDNIYADGPIQSEVKLDDGTIWKNITTPEKSKVAETLTEFRGNYIYN
LLDENIKRFNAEVPILAQWDDHETRNNWYPGQIILNDDRYTVKDVNLLTQRARQAFLEYL
PIGYTTNEPDKARIYRSFKHGPLLDIFMLDERTYRGPNSPNNQPVPSKDTEFAGRIQIQW
LKRQLLSSKATWKVIASDMPLGLIVRDGSTDFEAWANGDGPALGRELELADLLRFIKNKN
IQNVVWLTADVHYAAAHYYDPSKAQFTDFKPFWEFVAGPLNSGTFGPNQLENTFGPQLIF
QSLPPGTKANRPPSEGLQFFGGVKIDGNTKVMTVTLRNLAGETVYSIDLPPEK
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggaatctcataaccaattgaggttaaaccgtcgccagtttctgctacgttcagctata
accgcaggtggaattatctccaccaattttgtatcaaaatcaaaagtttttgctgaagcg
cctgcaattatcacctcagataaaatgcgtcctgccataccttatggcgtagctagcgga
gatatttctaacgaaagtattgtcatttggagccgtagcgatcgccccgccaaaatgctc
gtagaatactctaccagcgaatcttttagaaatgtgcagcgagttgtcggccccaatgct
ttacaaaatagcgactttacagcacgactttatcttagaaacctgccaccagaccaacaa
ttattttatcgggtaatcttccaagatttagattataaaggcacttacagcgctcctgtc
aaaggtactttccgaactcctcccaaatctaggcgagatatattctttgtttggggtggc
gacactgccggtcagggatggggaattaatcctgattttggtgggatgaaaatttacgaa
accatgcgtcaacttaatcccgactttttcattcactctggcgataatatttatgctgat
ggccccattcaatcagaagttaagctagacgatggcacaatctggaaaaacatcactaca
ccagaaaaatccaaagtagcagaaactctgacagaatttcgtggcaactatatttacaat
ttgttggatgaaaacatcaagcgtttcaacgctgaagttccgatattagcacagtgggac
gaccacgaaacaagaaacaattggtatcctggacaaattatccttaacgatgaccgttat
acagttaaggatgttaacttgctaactcaaagagcaaggcaagcatttttggaatatctg
cctattggttatacaaccaatgagccagacaaagcgagaatttatcgctcctttaagcat
gggccattattagacatcttcatgctggatgagcgtacctatcgggggccgaatagccct
aataatcagccagtaccaagtaaagacacagaatttgcgggtagaatacaaatacaatgg
ttaaaaaggcaattgctgtcatcaaaagcaacatggaaagtgattgctagtgatatgcca
ctgggattgatagttagagacggtagtactgattttgaagcttgggctaacggagatggc
ccggctttaggaagagaactagaacttgccgatttactacgatttatcaaaaataagaat
atccagaatgttgtttggttaactgctgatgtacattatgcagcagcccactattacgac
cccagcaaagcacagtttacagactttaagcctttttgggagtttgtcgccgggcctttg
aactctggcacatttggcccaaaccaactagaaaatacctttggtccccaattgatattt
caaagccttcctccaggtacaaaagcaaatcgtcccccaagtgaaggtttgcaattcttt
ggaggagtgaaaattgatggaaatacaaaggtgatgactgtaacattgcgtaacttggct
ggggagactgtttacagtattgatttgccgccagaaaaataa

DBGET integrated database retrieval system