KEGG   Nostoc punctiforme: Npun_R3764Help
Entry
Npun_R3764        CDS       T00713                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
npu  Nostoc punctiforme
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Npun_R3764
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Npun_R3764
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Npun_R3764
Enzymes [BR:npu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Npun_R3764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(4747370..4748971)
Genome map
AA seq 533 aa AA seqDB search
MESHNQLRLNRRQFLLRSAITAGGIISTNFVSKSKVFAEAPAIITSDKMRPAIPYGVASG
DISNESIVIWSRSDRPAKMLVEYSTSESFRNVQRVVGPNALQNSDFTARLYLRNLPPDQQ
LFYRVIFQDLDYKGTYSAPVKGTFRTPPKSRRDIFFVWGGDTAGQGWGINPDFGGMKIYE
TMRQLNPDFFIHSGDNIYADGPIQSEVKLDDGTIWKNITTPEKSKVAETLTEFRGNYIYN
LLDENIKRFNAEVPILAQWDDHETRNNWYPGQIILNDDRYTVKDVNLLTQRARQAFLEYL
PIGYTTNEPDKARIYRSFKHGPLLDIFMLDERTYRGPNSPNNQPVPSKDTEFAGRIQIQW
LKRQLLSSKATWKVIASDMPLGLIVRDGSTDFEAWANGDGPALGRELELADLLRFIKNKN
IQNVVWLTADVHYAAAHYYDPSKAQFTDFKPFWEFVAGPLNSGTFGPNQLENTFGPQLIF
QSLPPGTKANRPPSEGLQFFGGVKIDGNTKVMTVTLRNLAGETVYSIDLPPEK
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggaatctcataaccaattgaggttaaaccgtcgccagtttctgctacgttcagctata
accgcaggtggaattatctccaccaattttgtatcaaaatcaaaagtttttgctgaagcg
cctgcaattatcacctcagataaaatgcgtcctgccataccttatggcgtagctagcgga
gatatttctaacgaaagtattgtcatttggagccgtagcgatcgccccgccaaaatgctc
gtagaatactctaccagcgaatcttttagaaatgtgcagcgagttgtcggccccaatgct
ttacaaaatagcgactttacagcacgactttatcttagaaacctgccaccagaccaacaa
ttattttatcgggtaatcttccaagatttagattataaaggcacttacagcgctcctgtc
aaaggtactttccgaactcctcccaaatctaggcgagatatattctttgtttggggtggc
gacactgccggtcagggatggggaattaatcctgattttggtgggatgaaaatttacgaa
accatgcgtcaacttaatcccgactttttcattcactctggcgataatatttatgctgat
ggccccattcaatcagaagttaagctagacgatggcacaatctggaaaaacatcactaca
ccagaaaaatccaaagtagcagaaactctgacagaatttcgtggcaactatatttacaat
ttgttggatgaaaacatcaagcgtttcaacgctgaagttccgatattagcacagtgggac
gaccacgaaacaagaaacaattggtatcctggacaaattatccttaacgatgaccgttat
acagttaaggatgttaacttgctaactcaaagagcaaggcaagcatttttggaatatctg
cctattggttatacaaccaatgagccagacaaagcgagaatttatcgctcctttaagcat
gggccattattagacatcttcatgctggatgagcgtacctatcgggggccgaatagccct
aataatcagccagtaccaagtaaagacacagaatttgcgggtagaatacaaatacaatgg
ttaaaaaggcaattgctgtcatcaaaagcaacatggaaagtgattgctagtgatatgcca
ctgggattgatagttagagacggtagtactgattttgaagcttgggctaacggagatggc
ccggctttaggaagagaactagaacttgccgatttactacgatttatcaaaaataagaat
atccagaatgttgtttggttaactgctgatgtacattatgcagcagcccactattacgac
cccagcaaagcacagtttacagactttaagcctttttgggagtttgtcgccgggcctttg
aactctggcacatttggcccaaaccaactagaaaatacctttggtccccaattgatattt
caaagccttcctccaggtacaaaagcaaatcgtcccccaagtgaaggtttgcaattcttt
ggaggagtgaaaattgatggaaatacaaaggtgatgactgtaacattgcgtaacttggct
ggggagactgtttacagtattgatttgccgccagaaaaataa

DBGET integrated database retrieval system