KEGG   Nostoc punctiforme: Npun_R4173Help
Entry
Npun_R4173        CDS       T00713                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
npu  Nostoc punctiforme
Pathway
npu00260  Glycine, serine and threonine metabolism
npu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
npu01100  Metabolic pathways
npu01110  Biosynthesis of secondary metabolites
npu01130  Biosynthesis of antibiotics
npu01230  Biosynthesis of amino acids
Module
npu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Npun_R4173
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Npun_R4173
Enzymes [BR:npu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Npun_R4173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF1971
Motif
Other DBs
NCBI-ProteinID: ACC82550
JGI: NpR4173
CyanoBase: Npun_R4173
CYORF: Npun_R4173
UniProt: B2J8R2
Position
complement(5237619..5238854)
Genome map
AA seq 411 aa AA seqDB search
MTTTPLSPSSTAQVPDALGRFGRFGGKYVPETLMPALAELETAYQQYRNEPGFQAELQQL
LRDYVGRATPLYFAERLTAHYARPDRTGPQVYLKREDLNHTGAHKINNALGQVLLAKRMG
KQRIIAETGAGQHGVATATVCARFGLECVIYMGVHDMERQSLNVFRMRLMGAEVRPVEAG
TGTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHAVIGQETRTQAMEKWGT
LPDILLACVGGGSNAMGLFYEFINEPSIRFIGIEAAGEGVNTEKHAATLTKGRVGVLHGA
MSYLLQDEDGQIIEAHSISAGLDYPGVGPEHSYLKDTGRAEYYSVTDAEAMAAFQRLSKL
EGIIPALETAHAIAYLETLCPQLSGSPRIVINCSGRGDKDVQTVAKLLDPA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
gtgactaccactcccctctctccaagttcaactgctcaggttcccgatgcgttaggtcgc
tttggacgcttcggcggtaagtatgtacctgaaacgctaatgcctgcccttgctgaatta
gaaacagcttatcagcaataccgcaatgaacctggttttcaagcagaattacagcagttg
ttacgagactatgtgggacgcgccacaccattgtatttcgcggaacgcctgactgctcat
tatgcgcgacccgatcgcactgggccacaagtttacttaaagcgtgaagatttaaatcat
accggcgctcacaaaatcaataatgcccttggtcaggttttgttagcgaaacgcatgggt
aagcaacggattattgccgaaactggtgctggacaacatggagttgctacagccacagtt
tgcgctcgttttgggctggaatgcgtaatttatatgggcgttcatgatatggaacgccaa
tctttaaatgttttcagaatgcggttgatgggggcagaagtgcgtccggtggaagcggga
actggaaccctgaaagatgccacttctgaagcaatccgcgattgggtaacaaatgtggaa
acaactcactacatccttggttcagtagcaggtccccatccctacccgatgatggtacgt
gatttccatgcagtaatcgggcaagaaactcgcacccaagcaatggaaaagtggggtaca
ctgcctgatattctcttggcttgtgtaggtggtggttccaatgcaatgggactattttat
gagtttattaatgagccttctatccggttcattggaattgaagcagccggagaaggtgtt
aataccgaaaaacacgcagcaaccttgacaaaagggcgagttggtgtattacacggagca
atgagctatctattacaagatgaggatgggcagatcattgaggcgcactcaattagtgca
gggttagattatcccggtgtggggccagaacatagctatttgaaagacaccggtcgcgct
gaatattatagtgtgacagatgcagaggcaatggcagcattccagcgattatcgaaattg
gaagggattatcccagcattagaaacagcccatgcgatcgcatatctcgaaaccttatgt
ccccaactaagcggcagtccccgaattgtaattaactgctctggacgcggtgataaagat
gtacaaacggtagccaagttattagatccagcgtaa

DBGET integrated database retrieval system