KEGG   Nostoc punctiforme: Npun_R4322Help
Entry
Npun_R4322        CDS       T00713                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
npu  Nostoc punctiforme
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Npun_R4322 (tpiA)
   01230 Biosynthesis of amino acids
    Npun_R4322 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Npun_R4322 (tpiA)
   00051 Fructose and mannose metabolism
    Npun_R4322 (tpiA)
   00562 Inositol phosphate metabolism
    Npun_R4322 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Npun_R4322 (tpiA)
Enzymes [BR:npu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Npun_R4322 (tpiA)
Exosome [BR:npu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Npun_R4322 (tpiA)
  Exosomal proteins of bladder cancer cells
   Npun_R4322 (tpiA)
  Exosomal proteins of melanoma cells
   Npun_R4322 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5410307..5411038)
Genome map
AA seq 243 aa AA seqDB search
MRKIVIAGNWKMFKTQAETQEFLQGFLPHLEETPQGREVILCPPFTDLSVLSKTLHGSLI
QLGAQNIHWEEFGAYTGEISGPMLTESGVRFVIVGHSERRQYFGETDATVNLRLRTAQRF
GLTPILCVGETKQQRDAGETESLIALQLDKGLVDIDQNNLVIAYEPIWAIGTGETCEAVE
ANRIIGLIRSQLSNPNVSIQYGGSVKPNNIDEIMAQPEIDGVLVGGASLEPESFARIVNF
HLV
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgcggaaaatcgttattgccggcaactggaaaatgttcaaaacccaggcagagactcag
gagtttttgcaaggatttttgccccacttagaggaaaccccccaagggcgagaagtaata
ttgtgtcctcctttcactgatttaagcgttttgtccaagactttgcacggtagcctcatc
caactgggggcacaaaatatccattgggaagaatttggagcctatacgggtgagatttct
ggcccgatgctgacagaaagcggtgtgcgctttgtgattgtcggtcatagcgaacgacgg
caatactttggtgaaacggacgcaactgttaatctgcgcctccgaactgctcaaaggttt
ggtttgactccaattctctgtgttggtgaaactaaacaacaacgagatgcaggagaaact
gaatcactgattgctctccaactcgacaaaggtttggtagatatcgatcagaataatttg
gtgattgcctacgagccaatttgggcaattggcactggtgaaacttgtgaagcagtggaa
gctaatcgaataattggcttaattcggagccagttgagtaatccaaatgtatcaattcaa
tatggtggctcagtgaagccaaataatattgatgaaatcatggctcaaccagaaatcgat
ggcgttttagtcggaggagcaagtttagaaccggagagtttcgctcggattgtgaatttt
cacttagtgtaa

DBGET integrated database retrieval system