KEGG   Nostoc punctiforme: Npun_R4585Help
Entry
Npun_R4585        CDS       T00713                                 

Definition
heme oxygenase (EC:1.14.99.3)
Orthology
K00510  
heme oxygenase [EC:1.14.99.3]
Organism
npu  Nostoc punctiforme
Pathway
Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Npun_R4585
Enzymes [BR:npu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.3  heme oxygenase (biliverdin-producing)
     Npun_R4585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5699302..5700018)
Genome map
AA seq 238 aa AA seqDB search
MSSNLAIKLRSGTQQAHTSAENVGFMKCFLQGVVDRDCFAKFLSNLYYVYSELEAALDSH
AKHPVISAVYFPELNRQSSLEKDMVFYYGDNWRGQITPSPAAQKYIDRIREISASEPALL
LGHAYTRYMGDLSGGQMLQKVAQSALKLSGYEGTSFYNFEQIPDKKAFKDKYRQVLNALP
IDDATAERIVAEANNAFGFNLQMAQELERSLIKALGQVLFNSLTRSQNSGSNEIGAAN
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcaatctcgccatcaaactgcgttctggaactcaacaagcccacacatcagca
gaaaatgtgggatttatgaaatgttttctacaaggagtggtggatagagactgctttgcc
aagttcttaagtaacttgtattacgtctacagcgaactagaagcggcattagatagccat
gcaaagcatcctgtaattagtgcggtttactttcctgaacttaatcgccaatcctcgctc
gaaaaagacatggtgttctattatggggataattggagaggccaaattacaccctcacct
gctgctcaaaagtacattgaccgcattcgggaaatttctgctagtgaaccggctttattg
ctaggtcatgcctacactcgctacatgggcgatctttctggaggccaaatgctacaaaaa
gttgctcagtcagctctgaagctttctggctatgaaggcacgtccttttacaattttgag
caaattcctgataaaaaagcatttaaggataagtatcgtcaggtattaaacgcgctacct
attgatgatgcaacagcagaacgaattgttgcagaagccaataatgcctttggatttaat
ttgcagatggctcaagagttagagagaagtctaattaaagcactcggccaagtcctgttt
aatagtctaactcgttcacagaattcaggtagcaatgaaataggtgcggctaattaa

DBGET integrated database retrieval system