KEGG   Nostoc punctiforme: Npun_R4585Help
Entry
Npun_R4585        CDS       T00713                                 

Definition
(GenBank) Haem oxygenase (EC:1.14.99.3)
  KO
K00510  
heme oxygenase (biliverdin-producing) [EC:1.14.14.18]
Organism
npu  Nostoc punctiforme
Pathway
Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Npun_R4585
Enzymes [BR:npu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     Npun_R4585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5699302..5700018)
Genome map
AA seq 238 aa AA seqDB search
MSSNLAIKLRSGTQQAHTSAENVGFMKCFLQGVVDRDCFAKFLSNLYYVYSELEAALDSH
AKHPVISAVYFPELNRQSSLEKDMVFYYGDNWRGQITPSPAAQKYIDRIREISASEPALL
LGHAYTRYMGDLSGGQMLQKVAQSALKLSGYEGTSFYNFEQIPDKKAFKDKYRQVLNALP
IDDATAERIVAEANNAFGFNLQMAQELERSLIKALGQVLFNSLTRSQNSGSNEIGAAN
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcaatctcgccatcaaactgcgttctggaactcaacaagcccacacatcagca
gaaaatgtgggatttatgaaatgttttctacaaggagtggtggatagagactgctttgcc
aagttcttaagtaacttgtattacgtctacagcgaactagaagcggcattagatagccat
gcaaagcatcctgtaattagtgcggtttactttcctgaacttaatcgccaatcctcgctc
gaaaaagacatggtgttctattatggggataattggagaggccaaattacaccctcacct
gctgctcaaaagtacattgaccgcattcgggaaatttctgctagtgaaccggctttattg
ctaggtcatgcctacactcgctacatgggcgatctttctggaggccaaatgctacaaaaa
gttgctcagtcagctctgaagctttctggctatgaaggcacgtccttttacaattttgag
caaattcctgataaaaaagcatttaaggataagtatcgtcaggtattaaacgcgctacct
attgatgatgcaacagcagaacgaattgttgcagaagccaataatgcctttggatttaat
ttgcagatggctcaagagttagagagaagtctaattaaagcactcggccaagtcctgttt
aatagtctaactcgttcacagaattcaggtagcaatgaaataggtgcggctaattaa

DBGET integrated database retrieval system