KEGG   Nostoc punctiforme: Npun_R4660Help
Entry
Npun_R4660        CDS       T00713                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
npu  Nostoc punctiforme
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:npu00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:npu00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5779249..5779734)
Genome map
AA seq 161 aa AA seqDB search
MSNTISDIAVKTINGEDKQLKDYTGKVLLIVNVASYCGYTSQYEGLEKLNQKYREQGLRI
LGFPCNDFGAQEPGSNEEIVQFCTSKYSVTFELFDKIHAKGPQQHPLYERLTKAVEPTGT
IAWNFEKFLVNKKGEVTARFNSSVQPNSPELIAIIEKELAK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacacaatttcggatatcgcagtcaagaccatcaacggtgaagataagcaatta
aaggattacaccggaaaggtacttttaattgtgaatgtagcttcctactgcggttatact
tctcaatacgaggggctagaaaagttgaaccagaagtatagggaacaaggattacgtatt
ttggggttcccctgtaacgattttggagcgcaggaaccaggaagtaatgaagaaattgtg
cagttctgcacgagtaaatatagtgttacctttgaactatttgataaaatccatgccaaa
ggtccacagcagcatccactttatgagcgacttaccaaagctgttgagccaacggggact
attgcttggaactttgaaaaatttttagttaataaaaaaggtgaagtgacagctagattt
aatagtagcgtacagcccaattcaccagagttaattgccataattgagaaagaattagca
aaatag

DBGET integrated database retrieval system