KEGG   Nostoc punctiforme: Npun_R5075Help
Entry
Npun_R5075        CDS       T00713                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
npu  Nostoc punctiforme
Pathway
npu00010  Glycolysis / Gluconeogenesis
npu00052  Galactose metabolism
npu00500  Starch and sucrose metabolism
npu00520  Amino sugar and nucleotide sugar metabolism
npu00521  Streptomycin biosynthesis
npu01100  Metabolic pathways
npu01110  Biosynthesis of secondary metabolites
npu01120  Microbial metabolism in diverse environments
npu01130  Biosynthesis of antibiotics
npu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Npun_R5075
   00052 Galactose metabolism
    Npun_R5075
   00500 Starch and sucrose metabolism
    Npun_R5075
   00520 Amino sugar and nucleotide sugar metabolism
    Npun_R5075
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Npun_R5075
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Npun_R5075
Enzymes [BR:npu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Npun_R5075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACC83410
JGI: NpR5075
CyanoBase: Npun_R5075
CYORF: Npun_R5075
UniProt: B2J224
Position
complement(6285304..6286329)
Genome map
AA seq 341 aa AA seqDB search
MTLLLAGDIGGTKTILQLVETSDSQGLHTIYQESYHSADFPDLVPIVQQFLIKANTPIPE
KACFAIAGPIVKNTAKLTNLAWFLDTERLQQELGIPHIYLINDFAAVGYGISGLQKQDLH
PLQVGKPQPETPIGIIGAGTGLGQGFLIKQGNNYQVFPSEGGHADFAPRNEIEFQLLKYL
LDKHDIQRISVERVVSGMGIVAIYQFLRDRKFAAESPDIAQIVRTWEQEAGQEEKSVDPG
AAIGTAALEKRDRLSEQTLQLFIEAYGAEAGNLALKLLPYGGLYIAGGIAPKILPLIQNS
GFLLNFTQKGRMRPLLEEIPVYIILNPQVGLIGAALCAARL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgactttattactagcaggagacatcggcggtacgaaaactattttgcaattggttgaa
acatcagattcacaaggtttacatactatttatcaggaaagttaccacagtgctgatttt
cccgatttagtacctatagtgcagcagtttttaatcaaagctaatacaccaataccagaa
aaggcttgttttgcgatcgcagggcccattgtcaaaaatactgccaaactgaccaattta
gcctggttcctagataccgaacgtctacaacaagaattgggtatcccacatatttatttg
attaacgacttcgccgccgttggctatggcatttcaggtttacaaaaacaagacttgcac
ccgttgcaagttgggaaacctcaacccgaaaccccgattggaattattggtgctggtact
ggcttagggcaaggatttttaattaagcagggaaacaactatcaagtttttccttcagaa
ggtggacacgctgacttcgcgcctcggaacgagatagagtttcaattgttgaaatacctg
ctggataaacatgatatccagcgcatttctgtagaacgggtagtttctggaatgggaatt
gtggcgatttaccaatttttgcgcgatcgcaaatttgccgccgaatcaccagatatcgcc
caaatcgtcagaacttgggaacaagaagccggacaggaagagaaaagtgtcgatcccggt
gctgctattggtacagctgcactagaaaaacgcgatcgcctttccgaacaaaccttgcaa
ttatttatagaagcttatggtgcagaagccggcaatctcgcccttaaactcctaccttat
ggtggcttatacattgctggtggaattgcgcctaaaattctccccttaatccaaaatagc
ggtttcttattaaacttcacccaaaaaggcaggatgcgccccctcctggaagagatacct
gtgtatattatcctcaacccacaagtggggctaataggtgctgctttatgtgctgctagg
ttataa

DBGET integrated database retrieval system