KEGG   Neorickettsia risticii: NRI_0209Help
Entry
NRI_0209          CDS       T00951                                 

Gene name
rpiB
Definition
ribose 5-phosphate isomerase B (EC:5.3.1.6)
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
nri  Neorickettsia risticii
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:nri00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NRI_0209 (rpiB)
   01230 Biosynthesis of amino acids
    NRI_0209 (rpiB)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NRI_0209 (rpiB)
   00051 Fructose and mannose metabolism
    NRI_0209 (rpiB)
Enzymes [BR:nri01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     NRI_0209 (rpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
194304..194744
Genome map
AA seq 146 aa AA seqDB search
MRVSIGADHAGFALKAVLIDFFKARGCSPVDRGAYCSDVSDYPDFAKSVSLDVLDGRVDF
GILICGSGIGMSITANRYKKIRAALCYDVRAAKMAREHNDANVLCLAGRALTVSRCLEIV
EVFVSSEFSCEERHKKRIEKIDVGGE
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgagggtttccataggtgctgatcatgcggggttcgcactcaaagcagttttaatagac
ttctttaaggcacggggctgttccccggtggataggggtgcgtattgctcagatgtttct
gattatcctgattttgctaagtctgtttccttagacgtattggacggaagggtggatttt
ggcattttaatatgtggttctggaatcgggatgagtataactgctaacaggtacaaaaag
atccgtgctgccctgtgttacgatgtgcgagcagcaaagatggctagggaacataatgat
gcaaacgtcttatgtcttgcaggaagagctctaactgtgtcaaggtgtcttgaaatagtt
gaagtatttgtgagtagtgagtttagttgtgaagagcgtcacaagaaaaggatagaaaag
attgatgtgggaggggaatag

DBGET integrated database retrieval system