KEGG   Neorickettsia risticii: NRI_0209Help
Entry
NRI_0209          CDS       T00951                                 

Gene name
rpiB
Definition
(GenBank) ribose 5-phosphate isomerase B
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
nri  Neorickettsia risticii
Pathway
nri00030  Pentose phosphate pathway
nri00051  Fructose and mannose metabolism
nri01100  Metabolic pathways
nri01110  Biosynthesis of secondary metabolites
nri01120  Microbial metabolism in diverse environments
nri01130  Biosynthesis of antibiotics
nri01200  Carbon metabolism
nri01230  Biosynthesis of amino acids
Module
nri_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:nri00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NRI_0209 (rpiB)
   00051 Fructose and mannose metabolism
    NRI_0209 (rpiB)
Enzymes [BR:nri01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     NRI_0209 (rpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB
Motif
Other DBs
NCBI-ProteinID: ACT69211
UniProt: C6V485
Position
194304..194744
Genome map
AA seq 146 aa AA seqDB search
MRVSIGADHAGFALKAVLIDFFKARGCSPVDRGAYCSDVSDYPDFAKSVSLDVLDGRVDF
GILICGSGIGMSITANRYKKIRAALCYDVRAAKMAREHNDANVLCLAGRALTVSRCLEIV
EVFVSSEFSCEERHKKRIEKIDVGGE
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgagggtttccataggtgctgatcatgcggggttcgcactcaaagcagttttaatagac
ttctttaaggcacggggctgttccccggtggataggggtgcgtattgctcagatgtttct
gattatcctgattttgctaagtctgtttccttagacgtattggacggaagggtggatttt
ggcattttaatatgtggttctggaatcgggatgagtataactgctaacaggtacaaaaag
atccgtgctgccctgtgttacgatgtgcgagcagcaaagatggctagggaacataatgat
gcaaacgtcttatgtcttgcaggaagagctctaactgtgtcaaggtgtcttgaaatagtt
gaagtatttgtgagtagtgagtttagttgtgaagagcgtcacaagaaaaggatagaaaag
attgatgtgggaggggaatag

DBGET integrated database retrieval system