KEGG   Neorickettsia risticii: NRI_0236Help
Entry
NRI_0236          CDS       T00951                                 

Definition
Mur ligase middle domain family
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
nri  Neorickettsia risticii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nri00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    NRI_0236
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NRI_0236
Enzymes [BR:nri01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     NRI_0236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(219047..220459)
Genome map
AA seq 470 aa AA seqDB search
MAALYEQICLEISKGRIKNITSDPQKVGKDFLFYAPSEKEHAHIREAINRGAKSILTNQK
YEECLEQGVDFFVHAQPQQIYHGICSFMWKKQPTFVCAIIGTSGRKSVGHFFSQVCTLAG
KKAVTLSVSNEPMDTPKLWQEKDHLISDAADMYNILDDLAERRIEYCCLAISAAAIESRM
IDSVNLKAAAFTNLLRDDLEQPEDVDRRLQTKIRLLSEILPENGIMVLPVASEYTTRIMQ
HCPNKKVCTYGRATSDIQLISQLPTQKGQILTMKILGKEMVVHTNILGKFQGNNLVTAMG
LAISCGIDPSSIEHEQISPLAGYMEFLEDYGEERKIMTDCAQTPSELHDLLLSIKWHFPY
NDVTLVLRCSENYEARNTLKMAKIAAKMVNRIIFTSDSHGSMLTEKTRRELMSCCPKAIE
IEDRKKAMEYAINNCKPSEIIVMQGVKSSIDKSSVADDAAAMLKAVVAPQ
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgctatacgagcaaatttgcctagaaatatcaaagggaagaatcaagaacatt
acttcggatcctcaaaaagttgggaaagatttcctattttatgcgccatcagaaaaagaa
cacgcacacatccgggaggcaatcaatcgtggcgcgaagagcatactaacaaatcaaaaa
tatgaagaatgcctcgaacaaggtgttgatttctttgtgcacgctcaaccacagcagata
tatcacggaatatgctctttcatgtggaagaaacagccaacatttgtgtgtgcaataatt
ggtacaagtggaaggaaaagtgtcgggcattttttctctcaagtatgcacactagccgga
aaaaaagccgtcactttgagtgtgtcaaacgaaccaatggacactcccaagttatggcaa
gaaaaagatcatctgatatcagatgctgcagacatgtacaacattcttgacgatctagca
gagagaaggatcgaatattgttgcttagcgatttcagctgcagcaattgaaagcaggatg
atagatagtgttaacttaaaggctgctgctttcaccaatctgctacgcgacgatttagaa
caacctgaagatgtagatagacgccttcagacgaaaataaggctgctctcagagatatta
cccgagaatggcattatggtgctaccagtcgctagtgagtacacaacaagaataatgcaa
cactgtccaaataaaaaagtttgcacatacggaagagccacaagcgacatacaattgatc
tctcaattgccaacacaaaaaggacaaatactaacaatgaaaatccttggaaaggaaatg
gttgttcatacaaatatactcggaaagttccaagggaataatcttgtaacagcaatggga
ttagctatctcatgcggcatagatccatccagcattgaacatgaacaaattagcccattg
gctgggtatatggagtttctagaagactacggagaggagcgcaaaattatgacagattgt
gcccaaaccccgagtgaactgcatgatcttctactttctatcaagtggcattttccgtat
aatgatgtcaccctcgtgctcagatgcagcgagaattatgaggcaaggaataccctaaag
atggccaaaatcgcagcaaaaatggtaaataggataatcttcactagcgatagccatggt
agcatgttaacggagaaaactcggcgcgaacttatgtcttgctgcccaaaggcaattgaa
attgaggatagaaaaaaagcgatggaatacgcgataaataactgcaaaccgtccgagatt
atcgtgatgcaaggggtgaaatcatcaatagacaagagtagtgttgcagacgacgcagct
gcaatgctaaaagcggtagttgctcctcaatag

DBGET integrated database retrieval system