KEGG   Neorickettsia risticii: NRI_0245Help
Entry
NRI_0245          CDS       T00951                                 

Gene name
tpiA
Definition
(RefSeq) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nri  Neorickettsia risticii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nri00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NRI_0245 (tpiA)
   01230 Biosynthesis of amino acids
    NRI_0245 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NRI_0245 (tpiA)
   00051 Fructose and mannose metabolism
    NRI_0245 (tpiA)
   00562 Inositol phosphate metabolism
    NRI_0245 (tpiA)
Enzymes [BR:nri01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NRI_0245 (tpiA)
Exosome [BR:nri04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NRI_0245 (tpiA)
  Exosomal proteins of bladder cancer cells
   NRI_0245 (tpiA)
  Exosomal proteins of melanoma cells
   NRI_0245 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
226756..227568
Genome map
AA seq 270 aa AA seqDB search
MATSEFSDKGFFLSVEIDIMDSRKDILESMETCVQRFVVANWKMNGSQQLCDVFVNRFST
FAFNPAVEIVIAPPAVYLGQMRTAVMSSDLPLALGAQDCASGDNTPSTGDISSRMFKEVG
ARYVLVGHSERRTLHCESSKVVGMKANAGLRSRLIPIICVGQNNRSISRESLTKQCRDSI
PMNSHDFIVAYEPVYAIGTGIVPSNEEIEEAVSLIKGAVGDAVPVLYGGSVSPANCSEIF
GVKNLGGVLVGGASLDPDSFIKICEVANRF
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
ttggcaacttcggagttttccgacaaaggcttttttttatctgttgaaattgatatcatg
gattcccgcaaggatatattggagagtatggaaacttgtgtgcaacgcttcgtggttgca
aactggaagatgaatggcagtcagcaattgtgtgacgtttttgtgaatcgcttttctact
tttgctttcaaccctgcggtcgagattgtgatagcacctccggctgtctatttaggacag
atgagaactgctgtaatgtcttctgatttgcccttagctctgggagcacaggattgtgct
tcaggtgataatactcctagcactggtgacataagttctaggatgtttaaagaggttggt
gcgaggtatgtccttgtaggacattccgagaggaggactttgcactgtgaatcgagtaaa
gtggtgggtatgaaggccaatgctggattgcgcagtcgccttataccgatcatttgtgtt
gggcagaataacaggtccataagcagagagagtctgaccaagcaatgtagggattcaatt
ccaatgaatagccacgacttcatagtggcttacgagccggtctatgcaataggaacaggt
attgtgccttcgaacgaagagattgaagaggcggtcagtttaatcaagggtgctgtcggg
gatgcagtaccggtgctttatggtggttctgtttctccagctaattgctcagagattttt
ggtgtgaaaaaccttggtggagtgcttgtaggtggtgcgagcttagatccggatagtttc
atcaagatctgtgaggttgcaaatcggttttga

DBGET integrated database retrieval system