KEGG   Neorickettsia risticii: NRI_0245Help
Entry
NRI_0245          CDS       T00951                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nri  Neorickettsia risticii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:nri01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:nri01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nri00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:nri00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:nri00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
226756..227568
Genome map
AA seq 270 aa AA seqDB search
MATSEFSDKGFFLSVEIDIMDSRKDILESMETCVQRFVVANWKMNGSQQLCDVFVNRFST
FAFNPAVEIVIAPPAVYLGQMRTAVMSSDLPLALGAQDCASGDNTPSTGDISSRMFKEVG
ARYVLVGHSERRTLHCESSKVVGMKANAGLRSRLIPIICVGQNNRSISRESLTKQCRDSI
PMNSHDFIVAYEPVYAIGTGIVPSNEEIEEAVSLIKGAVGDAVPVLYGGSVSPANCSEIF
GVKNLGGVLVGGASLDPDSFIKICEVANRF
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
ttggcaacttcggagttttccgacaaaggcttttttttatctgttgaaattgatatcatg
gattcccgcaaggatatattggagagtatggaaacttgtgtgcaacgcttcgtggttgca
aactggaagatgaatggcagtcagcaattgtgtgacgtttttgtgaatcgcttttctact
tttgctttcaaccctgcggtcgagattgtgatagcacctccggctgtctatttaggacag
atgagaactgctgtaatgtcttctgatttgcccttagctctgggagcacaggattgtgct
tcaggtgataatactcctagcactggtgacataagttctaggatgtttaaagaggttggt
gcgaggtatgtccttgtaggacattccgagaggaggactttgcactgtgaatcgagtaaa
gtggtgggtatgaaggccaatgctggattgcgcagtcgccttataccgatcatttgtgtt
gggcagaataacaggtccataagcagagagagtctgaccaagcaatgtagggattcaatt
ccaatgaatagccacgacttcatagtggcttacgagccggtctatgcaataggaacaggt
attgtgccttcgaacgaagagattgaagaggcggtcagtttaatcaagggtgctgtcggg
gatgcagtaccggtgctttatggtggttctgtttctccagctaattgctcagagattttt
ggtgtgaaaaaccttggtggagtgcttgtaggtggtgcgagcttagatccggatagtttc
atcaagatctgtgaggttgcaaatcggttttga

DBGET integrated database retrieval system