KEGG   Neorickettsia risticii: NRI_0415Help
Entry
NRI_0415          CDS       T00951                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nri  Neorickettsia risticii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nri00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NRI_0415
Enzymes [BR:nri01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NRI_0415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
369320..370030
Genome map
AA seq 236 aa AA seqDB search
MILITRPVEDAIYLQERLQGLKIESLVEPLFVLQPLCFDVATLVAAKVIVSSKNAIRALT
WSKASKDLQLYAMSDNIAKFAISSGFSNVLSCGCSTAKELEAYVLSYFGKDERVIYLSGA
EITRDIVSRCSEKGFRWVERRICYMMCPLKEFSNNVYVALRRKRISGVTLFSVQAAVLCK
SLFLNHGITPNFFSYFVMSHRIASTLDCDTVYVSSVPTLDALVDVIERHYYVGQRA
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgatcttgataacaaggccagtcgaggatgccatatatttgcaggagcggctacaaggt
ttgaaaatagaaagtcttgtggaaccactctttgtactgcaaccgctttgctttgatgtt
gccacactcgttgctgcaaaggtgattgtcagtagtaaaaatgccattagagccttaact
tggtccaaggccagtaaagatttacaattgtacgcaatgagtgacaatattgctaagttt
gcaatttctagtggattttctaatgttctttcgtgcggttgtagtacagctaaggaatta
gaagcttatgtgctttcttactttggcaaagatgagagggttatttatctttctggagcg
gaaataactagagatattgtttccagatgttcagaaaagggttttagatgggtagagcga
cgaatctgttatatgatgtgcccgctgaaagagttttccaataatgtgtatgttgcgtta
aggagaaagagaattagtggtgtaaccttgttttcagtgcaagcagcggttttgtgcaaa
tcattgtttcttaaccatggcataactccgaattttttctcttattttgttatgagccat
agaatagcatcgactttggattgtgatacagtttatgtgtctagtgtgcctactttagat
gcccttgttgatgtaatagaaaggcattactatgttgggcagagagcttaa

DBGET integrated database retrieval system