KEGG   Neorickettsia risticii: NRI_0448Help
Entry
NRI_0448          CDS       T00951                                 

Gene name
cycM
Definition
(GenBank) cytochrome c family protein
  KO
K08738  cytochrome c
Organism
nri  Neorickettsia risticii
Pathway
nri02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nri00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NRI_0448 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 3-alpha
Motif
Other DBs
NCBI-ProteinID: ACT69435
UniProt: C6V4W4
Position
complement(402382..402921)
Genome map
AA seq 179 aa AA seqDB search
MKGLEFNKLFASVLLFGITVLSVSNIVDVLYHPKEVAHYQYAVANAETVDSQKNKFDPAT
VDMATFFKDANIEEGKKLSKKCVACHTFEKGGHNKVGPNLWDILGKNKAHLGDAFKYSKA
LLEKGGTWDYSSMIHLLYKPASYIKGTKMSFAGLSNPQDIAHVILYLRSLSDSPVPLPE
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtctggaatttaataagctttttgcatctgtgcttctatttggaataacggtt
ctgtcggtaagcaacatagtggacgttctctaccatcccaaagaggttgcacattaccaa
tatgcagttgcaaatgctgaaactgtagactcacaaaaaaataaatttgatccggcaacc
gttgatatggctaccttctttaaagatgcaaatatagaagagggcaaaaaattatctaaa
aagtgtgttgcctgtcacacctttgaaaagggtggacataacaaagttggtcccaatctt
tgggatatcttgggaaaaaataaagctcacttgggggatgcatttaaatattccaaagct
ctactggaaaaaggtggtacctgggattatagctcaatgatacatctactatacaaacca
gcctcgtacatcaagggaaccaaaatgtcctttgcgggactttccaatcctcaggatata
gcacatgtaatactatacctacgtagtctctctgattcacccgtcccgctgccagaataa

DBGET integrated database retrieval system