KEGG   Neorickettsia risticii: NRI_0448Help
Entry
NRI_0448          CDS       T00951                                 

Gene name
cycM
Definition
cytochrome c family protein
Orthology
K08738  
cytochrome c
Organism
nri  Neorickettsia risticii
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:nri00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NRI_0448 (cycM)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NRI_0448 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(402382..402921)
Genome map
AA seq 179 aa AA seqDB search
MKGLEFNKLFASVLLFGITVLSVSNIVDVLYHPKEVAHYQYAVANAETVDSQKNKFDPAT
VDMATFFKDANIEEGKKLSKKCVACHTFEKGGHNKVGPNLWDILGKNKAHLGDAFKYSKA
LLEKGGTWDYSSMIHLLYKPASYIKGTKMSFAGLSNPQDIAHVILYLRSLSDSPVPLPE
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtctggaatttaataagctttttgcatctgtgcttctatttggaataacggtt
ctgtcggtaagcaacatagtggacgttctctaccatcccaaagaggttgcacattaccaa
tatgcagttgcaaatgctgaaactgtagactcacaaaaaaataaatttgatccggcaacc
gttgatatggctaccttctttaaagatgcaaatatagaagagggcaaaaaattatctaaa
aagtgtgttgcctgtcacacctttgaaaagggtggacataacaaagttggtcccaatctt
tgggatatcttgggaaaaaataaagctcacttgggggatgcatttaaatattccaaagct
ctactggaaaaaggtggtacctgggattatagctcaatgatacatctactatacaaacca
gcctcgtacatcaagggaaccaaaatgtcctttgcgggactttccaatcctcaggatata
gcacatgtaatactatacctacgtagtctctctgattcacccgtcccgctgccagaataa

DBGET integrated database retrieval system