KEGG   Neorickettsia risticii: NRI_0459Help
Entry
NRI_0459          CDS       T00951                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
nri  Neorickettsia risticii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nri00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(412774..413559)
Genome map
AA seq 261 aa AA seqDB search
MISKIVGVLNITPDSFFDGGKFFKKDDAIRHALHMIQNGADIIEMGAESTRPDGDPISQR
EEINRLDGILPEIVELCKKHGIVAAIDSYNPETVEFALENGVTFINSQKNIEEVAKLLVR
KGKVDFPLVLPHALTIPVKGDLNLPDNIDVIETLKTWFEEKLAVLESIGIPRKNILIDPG
LGFGKTNQQCYTIIKSVESLRCFSLPIFAGHSNKRLVKHLNDQCPGVNFTLPISAILLTK
KVEYIRVHSVKEHHVLRSNFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaaaaatcgttggggttttaaatattaccccggattcatttttcgatggagga
aaattttttaagaaggatgatgctataaggcacgcactgcacatgatacaaaatggcgct
gatataatagaaatgggtgcggagtcaacaagaccagatggagatccaatttcacagagg
gaagaaataaaccgcctagacggaatcctaccggagatagtagagctatgtaagaagcat
ggtatcgttgcagcgatcgatagttacaatccagaaacggtggaatttgctctagaaaac
ggcgttacatttattaacagtcagaaaaatatagaggaagtagcaaaactccttgttaga
aaaggcaaggtagattttccacttgtcttacctcatgcattaaccataccagtaaaaggg
gatcttaaccttccggataatatagatgtcattgaaaccttaaaaacctggtttgaagaa
aaattagcagttttggagtcaataggtataccaaggaaaaatatcctaatcgacccaggt
ttaggctttgggaaaacgaatcagcagtgctatacaattataaagagtgtagaaagccta
aggtgtttctccttgccgattttcgctggtcactcaaacaaaaggctcgttaagcactta
aatgatcagtgtcctggagtaaatttcacccttcctatatccgctatcttacttacaaaa
aaagttgagtacataagggtgcactcagtaaaggaacaccatgtgttacgttcaaacttc
ttttaa

DBGET integrated database retrieval system