KEGG   Neorickettsia risticii: NRI_0483Help
Entry
NRI_0483          CDS       T00951                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nri  Neorickettsia risticii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nri00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nri00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
441690..442568
Genome map
AA seq 292 aa AA seqDB search
MRSLLTNNDITVDEIYEIFDLAAFYLKNGIKNDLLGKVVFSVFFESSTRTETSFSLAASK
LGCLVEKVNVATVALKKGEHLVDFFTSLNGLSPNAFIIRHSQSGVLHILEKYIDCCIVNA
GDGTNEHPTQGLIDAFTVLLLKEKIEGLNILVCGDIIRSRVAHSTIPILQRLGATVSISG
PLSFMPTIQVEQIIYYDNFPAAAKSADVIIMLRTQTERTGQKVLAGTTAPFCLDENILKD
LSPDVLIMHPGPIHRNCEISNIVLDDPRCAILTQVRNSQYVRAAVLNFLIKS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtctactgactaataacgatattaccgttgatgagatttatgagatcttcgat
ctggctgctttctatttaaagaatggaattaagaatgatctgcttggaaaagtggttttc
tcggttttttttgagagctcgacacgcaccgaaacttctttttcgcttgctgcaagtaaa
ctcggttgcctagttgaaaaagtaaatgtagcaactgtcgcactaaaaaagggtgagcac
ttagtggatttttttacttccttaaatggcctttcaccaaacgcgttcataatacgacac
agccaaagtggtgttcttcatatcttagaaaaatatattgattgttgcattgttaatgca
ggtgacgggacaaacgaacatccaacgcagggattaatagatgcatttaccgtgctccta
ctgaaggaaaagatagagggtttaaatatacttgtctgtggagatattataaggagtaga
gttgctcattctactatacctatactccaaagacttggggcaaccgtttcaatttctgga
ccgctgagttttatgcccacaatccaagtagaacaaattatttactatgataactttcct
gcagcggctaaatctgctgatgtcataataatgctgcgtactcagaccgaacgtacggga
cagaaagttttggctggtactacggcccctttttgtcttgatgaaaatattctgaaagat
ttaagtcctgacgtgcttataatgcatccgggacctattcatagaaattgtgagatttca
aatattgtccttgatgaccctaggtgtgcaatacttacacaagtgaggaattcccaatat
gtaagagcagctgtattgaactttctcataaaaagttag

DBGET integrated database retrieval system