KEGG   Neorickettsia risticii: NRI_0483Help
Entry
NRI_0483          CDS       T00951                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nri  Neorickettsia risticii
Pathway
nri00240  Pyrimidine metabolism
nri00250  Alanine, aspartate and glutamate metabolism
nri01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nri00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NRI_0483
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NRI_0483
Enzymes [BR:nri01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     NRI_0483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace DUF1622
Motif
Other DBs
NCBI-ProteinID: ACT69463
UniProt: C6V4Z8
Position
441690..442568
Genome map
AA seq 292 aa AA seqDB search
MRSLLTNNDITVDEIYEIFDLAAFYLKNGIKNDLLGKVVFSVFFESSTRTETSFSLAASK
LGCLVEKVNVATVALKKGEHLVDFFTSLNGLSPNAFIIRHSQSGVLHILEKYIDCCIVNA
GDGTNEHPTQGLIDAFTVLLLKEKIEGLNILVCGDIIRSRVAHSTIPILQRLGATVSISG
PLSFMPTIQVEQIIYYDNFPAAAKSADVIIMLRTQTERTGQKVLAGTTAPFCLDENILKD
LSPDVLIMHPGPIHRNCEISNIVLDDPRCAILTQVRNSQYVRAAVLNFLIKS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtctactgactaataacgatattaccgttgatgagatttatgagatcttcgat
ctggctgctttctatttaaagaatggaattaagaatgatctgcttggaaaagtggttttc
tcggttttttttgagagctcgacacgcaccgaaacttctttttcgcttgctgcaagtaaa
ctcggttgcctagttgaaaaagtaaatgtagcaactgtcgcactaaaaaagggtgagcac
ttagtggatttttttacttccttaaatggcctttcaccaaacgcgttcataatacgacac
agccaaagtggtgttcttcatatcttagaaaaatatattgattgttgcattgttaatgca
ggtgacgggacaaacgaacatccaacgcagggattaatagatgcatttaccgtgctccta
ctgaaggaaaagatagagggtttaaatatacttgtctgtggagatattataaggagtaga
gttgctcattctactatacctatactccaaagacttggggcaaccgtttcaatttctgga
ccgctgagttttatgcccacaatccaagtagaacaaattatttactatgataactttcct
gcagcggctaaatctgctgatgtcataataatgctgcgtactcagaccgaacgtacggga
cagaaagttttggctggtactacggcccctttttgtcttgatgaaaatattctgaaagat
ttaagtcctgacgtgcttataatgcatccgggacctattcatagaaattgtgagatttca
aatattgtccttgatgaccctaggtgtgcaatacttacacaagtgaggaattcccaatat
gtaagagcagctgtattgaactttctcataaaaagttag

DBGET integrated database retrieval system