KEGG   Neorickettsia risticii: NRI_0550Help
Entry
NRI_0550          CDS       T00951                                 

Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
nri  Neorickettsia risticii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nri00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NRI_0550
Enzymes [BR:nri01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     NRI_0550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
512250..512831
Genome map
AA seq 193 aa AA seqDB search
MIGKLTGTVTDLCQESLILDVGGVGYNVFTTRRLIDSLRTGQNLSLYIEHYFSENINKLY
GFECKKSQEVARMLSKVKGINYKIALSLLNHLELGELILAIQNKDESRLKIKGIGEKLVK
RIITETYEDFLKLDLQLPGTVSSTNIHIVSEAVSALVKLGFQHKPSHKVVMEIMTNQPAI
EIAELITLALKML
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgataggtaaactcacaggcacggtaacagacctatgccaagaatctcttatattagac
gtaggcggagtaggatataacgtatttacaacacgtagactgattgacagtcttcgtact
gggcaaaatctatctttgtacatagagcattatttctccgagaatataaacaaactttac
ggatttgaatgcaaaaaatcgcaagaagtagcgagaatgctgagcaaagtaaagggaata
aactataagattgctctgagtctgctaaatcatctcgaactaggagagctgatcctagca
attcaaaataaagatgaatctcggttaaaaatcaaaggtataggagagaagctagtaaaa
cgcatcatcacagaaacgtatgaagacttcttgaagttagacttacaacttcctggaact
gtttcttcgacaaatatacatatagtaagtgaggccgtatctgcactagtaaagctaggt
tttcaacataaaccctcccataaagtggttatggaaatcatgacaaaccaacctgcaatt
gaaatagctgaactgatcacactagcactcaaaatgctgtag

DBGET integrated database retrieval system