KEGG   Nitratifractor salsuginis: Nitsa_0021Help
Entry
Nitsa_0021        CDS       T01405                                 

Definition
protein-l-isoaspartate o-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nsa  Nitratifractor salsuginis
Brite
Enzymes [BR:nsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Nitsa_0021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21568..22200
Genome map
AA seq 210 aa AA seqDB search
MVNALHLKKMVEDIDAKFPLEPWVREALLKVDREAFVPLGFRHLSYTLDALPMQEAQWIS
SPLTVAKMTQHLELEGVDSVLEIGCGSGYQAAVLAQIVRRVFTIERIEPLLREARERFRA
LGMSNIFTRYDDGQRGWKEYAPYERILFSATADRVPQVLFDQLAEGGILLAPVNEGGLQI
ITRYYKRNGRISSEAIEPCLFVPVLDGTQK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggtcaatgcgttgcacttgaaaaaaatggtcgaggatatcgacgccaaattccccctg
gagccctgggtgcgtgaggcgctcctgaaggtggaccgggaagccttcgtccctctggga
tttcggcatctctcctataccctggatgccctcccgatgcaggaggcgcagtggatctcc
tcacccctgacggtggccaagatgacccagcacctggagctcgaaggggtcgacagtgtg
ctggagatcggttgcgggagcggctaccaggcggcggtgcttgcccagatcgttcggcgg
gtcttcaccatcgaacggatcgaaccgttgctgcgggaggcgagagagcgtttccgagcc
ctgggaatgagcaatatctttacccgctacgacgacgggcagcggggatggaaagagtac
gctccctatgagcggatcctcttctccgccaccgccgacagggtgccccaggtcctcttc
gaccagctggccgaaggggggatcctcctggccccggtcaacgaggggggcctgcagatc
attacccgttactacaaacgcaacggccgtatcagctccgaagcgatcgaaccctgcctc
ttcgtcccggtcctggacgggacacaaaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system