KEGG   Nitratifractor salsuginis: Nitsa_0126Help
Entry
Nitsa_0126        CDS       T01405                                 

Definition
UDP-N-acetylmuramoylalanyl-d-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
nsa  Nitratifractor salsuginis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Nitsa_0126
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Nitsa_0126
Enzymes [BR:nsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Nitsa_0126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
115519..116823
Genome map
AA seq 434 aa AA seqDB search
MIVPIEEEGFGEITDNTRELKEGRALLATAQNAPYRGELTAEIKTLTPEELIDRWGLKDM
KVIGVTGTNGKTTTTALIYSLLIDLGYSAALQGTRGLFVDDRPIEEKHMTTPSILETLWN
MKRAKEAGAEYFVMEVSSHAIDQDRIEGLDFALKVHTNVTRDHLDYHGTLEEYRRVKSLF
FSDDSLKLLNKDEIKSITFNPKNAYTYGVEEPATFKVLAYSLQNGISAVVQFRQEQEAFF
SNMMGLFNLYNLLAAIASVKLLTDRPLAEICDVVENFGGVSGRMEVVSAKPTIIVDFAHT
DDGMYRVLDSLKDKDLVVVFGAGGDRDRGKRPRMGAVAGRFAKKIYVTSDNPRSEDPEAI
IAEILQGLKGKEGVRAIVDRREAIERAIDELQEDEILLILGKGDESTQEIAGVKHPFDDR
EVVRQILEKQGTQR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtgattgttcctatcgaagaggaggggtttggtgaaatcaccgacaatacccgggaattg
aaagaaggccgggcgcttctggcgacagcacagaatgccccttatcgcggtgaactcact
gccgagatcaaaacgctgacgccggaagagttgatcgatcgctggggcctgaaggatatg
aaggtgatcggtgtcaccggcaccaacggcaaaaccaccacgacggccctgatctactct
ttgctgatcgacctggggtattcggcggcgctgcaggggacgcgagggctctttgtcgac
gatcgtcccatcgaagagaagcatatgaccaccccttcgatcctggagaccctctggaat
atgaaacgggccaaggaggccggagcggaatatttcgtgatggaagtgagctctcacgcc
atcgaccaggatcggatcgaaggattggattttgccctcaaggtccacaccaatgtcact
cgggatcatttggattaccacgggaccctcgaagagtatcgccgggtcaaaagccttttc
ttttccgacgactccctcaaactcctgaacaaagacgagatcaaaagcattactttcaat
cccaagaatgcctacacctacggtgtagaggagcccgccactttcaaagtcctggcctat
tccctgcagaatggaatcagtgcggtcgttcaattccggcaggagcaggaagcctttttc
tcaaatatgatggggcttttcaacctctacaacctcctggcggccatcgcctcggtcaaa
ctcctgaccgatcggcccttggcggagatctgcgatgtggtggagaatttcggcggggtc
agcggtcggatggaagtcgtaagtgccaagccgacgatcatcgtcgatttcgcccatacc
gacgacgggatgtatcgggtcctcgacagtctcaaggataaggatctagtcgttgtcttc
ggtgcgggaggagaccgggaccgtggcaagcgcccccggatgggagccgtggccgggcgt
tttgccaagaaaatctacgtcaccagtgacaatccccgcagtgaagatcccgaagcgatc
atcgccgagatcctccagggcctcaaaggcaaagaaggcgtccgggccatcgtggatcga
cgtgaagcgattgaacgtgccatcgatgagctccaggaggatgagatccttttgatcctg
ggcaaaggggatgagagtacccaggagatcgccggggtcaagcaccctttcgacgatagg
gaagtggtgcgacagattcttgaaaagcaagggacacaacgctag

DBGET integrated database retrieval system