KEGG   Nitratifractor salsuginis: Nitsa_0188Help
Entry
Nitsa_0188        CDS       T01405                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nsa  Nitratifractor salsuginis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nitsa_0188
   01230 Biosynthesis of amino acids
    Nitsa_0188
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nitsa_0188
   00051 Fructose and mannose metabolism
    Nitsa_0188
   00562 Inositol phosphate metabolism
    Nitsa_0188
Enzymes [BR:nsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Nitsa_0188
Exosome [BR:nsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Nitsa_0188
  Exosomal proteins of bladder cancer cells
   Nitsa_0188
  Exosomal proteins of melanoma cells
   Nitsa_0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
175779..176486
Genome map
AA seq 235 aa AA seqDB search
MIFAANFKMHHTRQSTTEYLDRLEALLERAEYPFKVMVFPPATALQPSREWITVGAQNAY
PAEEGAYTGEIGLSQLHEFEIDTVLIGHSERRQILGEDQEFIAKKFAFYREHGFQIIYCV
GEPLEVREQGFEAVAEYLWEQFDDIDIDYERLIVAYEPVWAIGTGQAAEPEAIAATHAEL
RRRIKRPILYGGSVNPTNIARIAEIPDVDGVLVGSASLDPEKFHALMIPVAPPQV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgattttcgcagccaatttcaaaatgcaccatacccgtcaaagtaccacagagtatctg
gatcgtctggaggctctattggagcgggcggagtaccccttcaaagtgatggttttccct
ccggcgacggccctgcagccttcccgggagtggatcaccgtgggcgcgcagaacgcctat
cccgccgaagagggggcctacaccggagagatcgggctgagtcagctgcatgagtttgag
attgatacggtgctgatcggccacagcgagcggcggcagatcctgggggaggaccaggag
ttcatcgccaaaaagttcgccttttaccgggagcacggttttcagatcatctactgcgtg
ggcgagcccctagaggttcgggaacagggcttcgaggcggtggccgaatatctctgggaa
cagttcgacgatatcgacatcgactatgagcggcttatcgtcgcctatgaaccggtctgg
gctatcgggacgggccaggcggccgagccggaagcgatcgccgcgacccacgccgagctg
cgccgccggatcaaacgccccatcctctacggcggcagtgtcaatcccaccaatatcgcc
cggatcgccgagatccctgatgtagacggtgtcctggtcgggagcgcttcccttgatccc
gagaagtttcacgccctgatgatccccgtggctccgccccaggtatga

DBGET integrated database retrieval system