KEGG   Nitratifractor salsuginis: Nitsa_0188Help
Entry
Nitsa_0188        CDS       T01405                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nsa  Nitratifractor salsuginis
Pathway
nsa00010  Glycolysis / Gluconeogenesis
nsa00051  Fructose and mannose metabolism
nsa00562  Inositol phosphate metabolism
nsa01100  Metabolic pathways
nsa01110  Biosynthesis of secondary metabolites
nsa01120  Microbial metabolism in diverse environments
nsa01130  Biosynthesis of antibiotics
nsa01200  Carbon metabolism
nsa01230  Biosynthesis of amino acids
Module
nsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nsa_M00002  Glycolysis, core module involving three-carbon compounds
nsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nitsa_0188
   00051 Fructose and mannose metabolism
    Nitsa_0188
   00562 Inositol phosphate metabolism
    Nitsa_0188
Enzymes [BR:nsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Nitsa_0188
Exosome [BR:nsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Nitsa_0188
  Exosomal proteins of bladder cancer cells
   Nitsa_0188
  Exosomal proteins of melanoma cells
   Nitsa_0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM SnoaL_2
Motif
Other DBs
NCBI-ProteinID: ADV45460
UniProt: E6WZ10
Position
175779..176486
Genome map
AA seq 235 aa AA seqDB search
MIFAANFKMHHTRQSTTEYLDRLEALLERAEYPFKVMVFPPATALQPSREWITVGAQNAY
PAEEGAYTGEIGLSQLHEFEIDTVLIGHSERRQILGEDQEFIAKKFAFYREHGFQIIYCV
GEPLEVREQGFEAVAEYLWEQFDDIDIDYERLIVAYEPVWAIGTGQAAEPEAIAATHAEL
RRRIKRPILYGGSVNPTNIARIAEIPDVDGVLVGSASLDPEKFHALMIPVAPPQV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgattttcgcagccaatttcaaaatgcaccatacccgtcaaagtaccacagagtatctg
gatcgtctggaggctctattggagcgggcggagtaccccttcaaagtgatggttttccct
ccggcgacggccctgcagccttcccgggagtggatcaccgtgggcgcgcagaacgcctat
cccgccgaagagggggcctacaccggagagatcgggctgagtcagctgcatgagtttgag
attgatacggtgctgatcggccacagcgagcggcggcagatcctgggggaggaccaggag
ttcatcgccaaaaagttcgccttttaccgggagcacggttttcagatcatctactgcgtg
ggcgagcccctagaggttcgggaacagggcttcgaggcggtggccgaatatctctgggaa
cagttcgacgatatcgacatcgactatgagcggcttatcgtcgcctatgaaccggtctgg
gctatcgggacgggccaggcggccgagccggaagcgatcgccgcgacccacgccgagctg
cgccgccggatcaaacgccccatcctctacggcggcagtgtcaatcccaccaatatcgcc
cggatcgccgagatccctgatgtagacggtgtcctggtcgggagcgcttcccttgatccc
gagaagtttcacgccctgatgatccccgtggctccgccccaggtatga

DBGET integrated database retrieval system