KEGG   Nitratifractor salsuginis: Nitsa_0248Help
Entry
Nitsa_0248        CDS       T01405                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nsa  Nitratifractor salsuginis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nitsa_0248
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nitsa_0248
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nitsa_0248
Enzymes [BR:nsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Nitsa_0248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(232578..233318)
Genome map
AA seq 246 aa AA seqDB search
MKKLVAYITTGYPDKAFTVDLALALAEAGVDTLELGIPFSDPVADGPVIESANLKALQKG
FRIADLFEVSRSIAPAIDTLWMGYFNPFYHKGMETFIAEAKASGVNGFIIPDLPYEEAQA
YKPMIEEAGLNLIDFIAPTDTPERIAMIARDAKKFLYLVAYAGITGSGQSEELSEVIAQI
RKQTQTPVYVGFGVNPDTAKEKAKGVDGVIVGSAFVKILLDEDRSLTERIEAVSQMAKVI
KEKINE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaactggtcgcctacattaccaccggataccccgacaaagcctttactgtcgac
ctggcgctggccctggccgaagccggggtggataccctggagctggggatccccttttcc
gatccggtcgccgacggccccgtcatcgagagcgccaacctcaaagcgctccaaaagggc
ttccgcatcgccgatctcttcgaagtttcccgctcgatcgctcctgccatcgataccctc
tggatgggttatttcaaccccttttaccacaaagggatggagactttcatcgccgaagcc
aaagcctcgggggtcaacggctttattatccccgacctcccctatgaagaggcacaggcc
tacaaaccgatgatcgaagaggcggggctgaatctcatcgacttcatcgcccccaccgat
accccggagcgcatcgcgatgatcgcccgggacgccaaaaagttcctctacctcgtcgcc
tacgccgggatcaccggcagcggccagagcgaagagctttccgaagtcattgcccagatc
cgcaagcagacccaaactcccgtctatgtaggattcggagtcaaccccgatacggcaaag
gaaaaagccaagggggtcgacggagtgatcgtcggctccgccttcgtgaagatcctgctc
gatgaggaccgctccctgacggaacgcatcgaagccgtcagccaaatggcgaaagtgatc
aaagaaaaaatcaacgaatag

DBGET integrated database retrieval system