KEGG   Nitratifractor salsuginis: Nitsa_0283Help
Entry
Nitsa_0283        CDS       T01405                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nsa  Nitratifractor salsuginis
Pathway
nsa00240  Pyrimidine metabolism
nsa00250  Alanine, aspartate and glutamate metabolism
nsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Nitsa_0283
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Nitsa_0283
Enzymes [BR:nsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Nitsa_0283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ADV45554
UniProt: E6WZH4
Position
complement(276193..277104)
Genome map
AA seq 303 aa AA seqDB search
MQHLVDTDQLSDAQIRQILEDASRFKTRKPAPLLSGKLLITLFFENSTRTRSSFEVAAKR
LGADMVHLDPSRSSTKKGETLEDTFANLCAMEPDGVIIRHSENDTPSRLAEMDQVPVINA
GAGNYAHPTQALLDLYTLYEWFGEEIEGLRVAIVGDIVNSRVAASDIRLFRRMGIEVSLV
APKPFMPPVSDLPQFERLEDIMDEVDVIISLRAQLERHKKPIFDDYSAYAEHYCITEDRL
EDRGIVIMHPGPVMRNIDISDEILEDPRCMVLDQVRNGVYVRMAVLKLLLLDAKEYGSDP
LHR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatctcgtcgataccgatcagctctccgacgcacagatccgtcaaatactcgag
gacgcttcacggttcaaaacccgcaagcccgccccactgctcagcggcaaactgctcatc
accctctttttcgaaaattccacccgaacccgcagctcctttgaagtggccgccaaacgg
ctcggagccgatatggtccacctcgacccttcccgaagctccaccaaaaagggagagacc
ctggaggataccttcgccaacctctgcgccatggaacccgacggggtcatcattcgccac
agcgaaaacgacaccccctcccgcctggcggagatggaccaggtccccgtcatcaacgcc
ggtgccggcaactatgcccatcccacccaggcgctgctcgacctctataccctttacgag
tggttcggagaagagatcgaaggattgcgcgtcgcgatcgtgggtgatatcgtcaattca
cgggtcgccgccagcgatatccggctctttagacgtatggggatcgaagtctccctggtc
gcgcccaagccctttatgccgccggtgagtgacctgccccagtttgagcggctcgaggat
atcatggatgaggtcgatgtgatcatcagcctccgcgcccagctcgagcgccataaaaaa
ccgatcttcgacgattacagcgcctatgccgagcactactgcattaccgaggatcgtctg
gaggatcgcgggatcgtgatcatgcaccccgggccggtcatgcgcaatatcgacatctcc
gacgagatactcgaagatccccgctgtatggtcctcgaccaggtgcgcaacggtgtctat
gtacggatggcggtcctgaaacttctcctcctcgatgccaaggagtacggatccgatcct
ctccatcgctag

DBGET integrated database retrieval system