KEGG   Nitratifractor salsuginis: Nitsa_0359Help
Entry
Nitsa_0359        CDS       T01405                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nsa  Nitratifractor salsuginis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nitsa_0359
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nitsa_0359
   00640 Propanoate metabolism
    Nitsa_0359
   00660 C5-Branched dibasic acid metabolism
    Nitsa_0359
Enzymes [BR:nsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Nitsa_0359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
369940..371112
Genome map
AA seq 390 aa AA seqDB search
MNIHEYQAKEIFRKYNVPVPRGKVAFTVDEAVEAAKELGGNLWVVKAQIHAGGRGLGGGV
KLAKSIDEVRHWADEILGMTLVTHQTGPEGKVVHKVYIEEGADIAKEFYLGMLLDRAAEM
PVMMASTEGGMEIEKVAAETPEKIVKVTIDPTIGFQGFHGRKLAFGLGLPKEEIGTFIKF
ASALYNAYMDNDAEMIEINPLIKTGDGKFLALDAKMGFDDNALYRHPDISEMRDLEEEEP
TELEAKAHGLSYIKLDGNVGCMVNGAGLAMATMDIIKHEGGEPANFLDVGGGANPETVAK
GFEIILKDPNVKAIFVNIFGGIVRCDRVANGILEATKITDVNVPVVVRLDGTNADEAAEI
LKNANIENIIAAENLADGARKAVAAAKGEL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtgaatattcatgagtatcaggcgaaagagatcttccgcaagtacaacgtccccgtaccc
cgcggaaaagttgccttcaccgtcgatgaggcggtggaagcggccaaagagctgggaggg
aatctctgggtagtcaaagcccagatccatgccggaggccgtggactcggcggcggggtc
aagctggccaagtccatcgacgaagtgcgccattgggccgatgaaatcctcggaatgacc
ctggtgacccatcagaccgggcccgaagggaaagtggtccacaaggtctatatcgaagag
ggtgccgacatcgccaaagagttctatctgggaatgctcctggaccgcgcggcggagatg
ccggtcatgatggcgtccaccgaagggggaatggagattgagaaggtcgcggccgaaacc
cctgaaaagatcgtcaaggtcaccatcgaccccaccatcggcttccagggattccacggg
cgcaagctggcctttggcctcggtctgcccaaagaggagatcgggactttcatcaaattc
gcttcggcgctctacaacgcctatatggacaacgacgccgagatgatcgagatcaacccc
ctgatcaagaccggagacgggaagtttctggcgctcgacgccaagatgggcttcgatgac
aatgcgctctaccgccatccggacatttcagagatgcgggacctcgaagaggaagagccc
accgagctcgaagccaaagcgcacggcctgagctacatcaagctcgacggcaatgtcggc
tgtatggtcaacggtgccggactggcgatggcgacgatggatatcatcaagcacgaaggg
ggcgagccggccaacttcctcgacgtgggaggcggggccaaccccgaaacggtcgcgaaa
ggcttcgagatcattctcaaagatcccaacgtcaaagcgatcttcgtcaacatcttcggc
gggatcgtccgctgcgaccgggttgccaacggcattctcgaagcgaccaagatcaccgat
gtgaatgtgcctgtggtcgtgcgcctggacggtaccaacgccgatgaagccgcagagatt
ctcaaaaacgccaatatcgaaaacatcattgccgccgaaaatcttgccgatggtgcccgc
aaagccgtcgccgctgcgaaaggagagctctaa

DBGET integrated database retrieval system