KEGG   Nitratifractor salsuginis: Nitsa_0398Help
Entry
Nitsa_0398        CDS       T01405                                 

Definition
l-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nsa  Nitratifractor salsuginis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nitsa_0398
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nitsa_0398
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nitsa_0398
Enzymes [BR:nsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nitsa_0398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
407268..408734
Genome map
AA seq 488 aa AA seqDB search
MQFIETRGNDGKNPAAVPFSEAILNPRASYGGLYVPESLPDMSIGFLSEYLQSDYKTLAF
ALLKAFEIDIDDELLHKALERYDRFDDPNNPVPVVGIEEDLYVSELYHGPTRAFKDMALQ
PFGVILSTLAKRRNERYLIMAATSGDTGPATLETFKNRENIKVTCLYPEGGTSDVQRLQM
VTEDAPNLKVIGVKGNFDDTQHALKELLSSETFREELRKRDLKLSAANSVNFGRIIFQII
YHIHSYLELVRQNVITLGEEIYLVVPSGNFGNALGAYYAKKAGLPVRKILIASNANNILT
DWIRKGEYDLRGRCLIQTESPAMDILISSNVERVLYDKFGPERTRELMEALSKEGHYSLT
PEELKSLQEDFDATFSSDEEGEKIIARYAERGYLMDPHTATCLKAYRELRREPLATVIYS
TAEWTKFSRTVARAIGIAAETDKEALDAVSRKLGVLIPKVISELFNKPIVHTTVVEKEEI
MQEMLSFL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttatcgaaacccgggggaatgacggcaagaaccccgcagccgtccccttttcc
gaggcgatcctcaatccccgcgccagttacggcgggctctatgtgcccgaatcgctgccg
gatatgagcatcggcttcctctccgaatatctccagagcgactacaaaaccctcgcgttt
gctttgctcaaagccttcgagatcgatatcgacgacgaactgctccacaaagctttggag
cgttacgaccgtttcgacgatcctaataacccggtccccgtggtcggcatcgaagaggat
ctctatgtcagcgaactctatcacggccccacccgggccttcaaggatatggcattgcaa
ccctttggtgtgatcctgagcacgctggcgaagcgccggaatgagcgctatctcatcatg
gctgccaccagcggggataccggcccggcgacgctggaaaccttcaaaaaccgggagaac
atcaaagtgacttgcctctatcccgagggggggaccagcgatgtccagcggctgcagatg
gtcaccgaggatgctcccaatctcaaagtgatcggggtcaaagggaatttcgacgatact
cagcacgcgctcaaagagcttctctcctccgagaccttccgcgaagagctgcgcaagcgg
gatttgaaactctcggcggccaactccgtcaacttcggccggatcattttccagatcatt
taccatatccacagctatctggagctcgtgcgtcaaaacgtcatcaccctgggcgaagag
atttacctcgtggtccccagcggaaattttggaaacgccctgggtgcctactatgccaag
aaagccggcttgcccgtccgcaaaatcctgatcgcttccaacgccaacaatatcctcacc
gactggatccgcaaaggggagtatgacttgcggggacgctgtctgatccagaccgaatct
cccgctatggacatcctcatcagctccaacgtcgagcgggtgctctacgacaaattcggc
cccgaacggacccgggaattgatggaagctctgagcaaagaggggcactacagcctgaca
cccgaggagctcaagagtctgcaggaagatttcgacgcgaccttcagcagcgacgaagag
ggggagaagatcatcgcccgctatgccgagcggggctacctgatggatccccataccgct
acctgcctcaaagcctatcgggaattgcgccgtgagccgctggcgacggtgatctattcg
acggcggagtggaccaagttcagccggaccgtcgcccgggccatcgggatcgcggcggaa
acggacaaagaggcgctcgatgccgtcagccgtaagctcggggttcttatccccaaggtc
atctccgaacttttcaacaaaccgatcgttcataccacggtggttgaaaaagaggagatc
atgcaggaaatgctctcctttctatga

DBGET integrated database retrieval system