KEGG   Nitratifractor salsuginis: Nitsa_0398Help
Entry
Nitsa_0398        CDS       T01405                                 

Definition
(RefSeq) l-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nsa  Nitratifractor salsuginis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nitsa_0398
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nitsa_0398
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nitsa_0398
Enzymes [BR:nsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nitsa_0398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
407268..408734
Genome map
AA seq 488 aa AA seqDB search
MQFIETRGNDGKNPAAVPFSEAILNPRASYGGLYVPESLPDMSIGFLSEYLQSDYKTLAF
ALLKAFEIDIDDELLHKALERYDRFDDPNNPVPVVGIEEDLYVSELYHGPTRAFKDMALQ
PFGVILSTLAKRRNERYLIMAATSGDTGPATLETFKNRENIKVTCLYPEGGTSDVQRLQM
VTEDAPNLKVIGVKGNFDDTQHALKELLSSETFREELRKRDLKLSAANSVNFGRIIFQII
YHIHSYLELVRQNVITLGEEIYLVVPSGNFGNALGAYYAKKAGLPVRKILIASNANNILT
DWIRKGEYDLRGRCLIQTESPAMDILISSNVERVLYDKFGPERTRELMEALSKEGHYSLT
PEELKSLQEDFDATFSSDEEGEKIIARYAERGYLMDPHTATCLKAYRELRREPLATVIYS
TAEWTKFSRTVARAIGIAAETDKEALDAVSRKLGVLIPKVISELFNKPIVHTTVVEKEEI
MQEMLSFL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttatcgaaacccgggggaatgacggcaagaaccccgcagccgtccccttttcc
gaggcgatcctcaatccccgcgccagttacggcgggctctatgtgcccgaatcgctgccg
gatatgagcatcggcttcctctccgaatatctccagagcgactacaaaaccctcgcgttt
gctttgctcaaagccttcgagatcgatatcgacgacgaactgctccacaaagctttggag
cgttacgaccgtttcgacgatcctaataacccggtccccgtggtcggcatcgaagaggat
ctctatgtcagcgaactctatcacggccccacccgggccttcaaggatatggcattgcaa
ccctttggtgtgatcctgagcacgctggcgaagcgccggaatgagcgctatctcatcatg
gctgccaccagcggggataccggcccggcgacgctggaaaccttcaaaaaccgggagaac
atcaaagtgacttgcctctatcccgagggggggaccagcgatgtccagcggctgcagatg
gtcaccgaggatgctcccaatctcaaagtgatcggggtcaaagggaatttcgacgatact
cagcacgcgctcaaagagcttctctcctccgagaccttccgcgaagagctgcgcaagcgg
gatttgaaactctcggcggccaactccgtcaacttcggccggatcattttccagatcatt
taccatatccacagctatctggagctcgtgcgtcaaaacgtcatcaccctgggcgaagag
atttacctcgtggtccccagcggaaattttggaaacgccctgggtgcctactatgccaag
aaagccggcttgcccgtccgcaaaatcctgatcgcttccaacgccaacaatatcctcacc
gactggatccgcaaaggggagtatgacttgcggggacgctgtctgatccagaccgaatct
cccgctatggacatcctcatcagctccaacgtcgagcgggtgctctacgacaaattcggc
cccgaacggacccgggaattgatggaagctctgagcaaagaggggcactacagcctgaca
cccgaggagctcaagagtctgcaggaagatttcgacgcgaccttcagcagcgacgaagag
ggggagaagatcatcgcccgctatgccgagcggggctacctgatggatccccataccgct
acctgcctcaaagcctatcgggaattgcgccgtgagccgctggcgacggtgatctattcg
acggcggagtggaccaagttcagccggaccgtcgcccgggccatcgggatcgcggcggaa
acggacaaagaggcgctcgatgccgtcagccgtaagctcggggttcttatccccaaggtc
atctccgaacttttcaacaaaccgatcgttcataccacggtggttgaaaaagaggagatc
atgcaggaaatgctctcctttctatga

DBGET integrated database retrieval system