KEGG   Nitratifractor salsuginis: Nitsa_0437Help
Entry
Nitsa_0437        CDS       T01405                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
nsa  Nitratifractor salsuginis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nsa01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:nsa00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
451568..452359
Genome map
AA seq 263 aa AA seqDB search
MKRIVIKVGSHVLTEEGEIALERMRALVDLIADLIRGGREVILVSSGAVAAGYTQLRLDR
SDVAQKQALAAIGQPYLLKLYQSKFAHHGILSAQLLLSADDFDSRRRTRHARNAVEELLK
HRVVPIVNENDVVATEELVFGDNDRLSAHVAHYFDADLLVILSDIDGYYDKDPHRYPDAR
LRKVVCALDAKELEAECTPHNAFATGGIVTKLQAADFLLKRGGRMFLASGFDLADVQSLL
LEGVHRGGTLFESSDARRGEEDE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggatcgtcattaaagtgggttcgcacgtcttgaccgaagagggagagatcgcc
ctggaacgtatgcgtgcactggtagaccttatcgcggatctgatccgcgggggcagggag
gtgatcctcgtcagttcgggagccgtggcggcgggatatacccagctgaggctcgatcgc
tccgatgtggcgcagaaacaggccttggcggcgatcggtcagccctatctcctgaagctc
tatcagagcaagttcgcccaccatggtattttgagtgcccagctgctcctcagcgccgac
gatttcgactcccgccgtcgaacccgtcacgcacgcaacgctgtcgaggagctcttgaag
catcgggtcgtcccgatcgtcaatgaaaacgatgtggtcgcgaccgaagagttggttttc
ggtgacaatgaccgtctcagtgcccatgtggcccactatttcgatgcggaccttttggtg
atcctctccgacatcgacggctattacgacaaagatccccatcgctaccccgatgcccgg
ctgcgcaaggtggtctgtgcactcgatgcgaaggagttggaagccgaatgcactccccat
aacgccttcgccaccggcgggatcgtaacgaagctgcaggcggcggattttcttctcaaa
cggggagggcgaatgttcctcgccagcggattcgatctcgctgatgtgcaaagcctgctc
ctggaaggggtgcaccgcggggggacgctttttgaaagttccgacgctcgacggggtgaa
gaggacgagtaa

DBGET integrated database retrieval system