KEGG   Nitratifractor salsuginis: Nitsa_0456Help
Entry
Nitsa_0456        CDS       T01405                                 

Definition
uroporphyrinogen iii synthase hem4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nsa  Nitratifractor salsuginis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Nitsa_0456
Enzymes [BR:nsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Nitsa_0456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
467108..467767
Genome map
AA seq 219 aa AA seqDB search
MNPRIYLTSPVEYPGTIPLPMIRFALVADRIDYQGCDTLMFTSKQAVLSAEAIDPDWKRL
PAIAIGPATQRQIETLGGEVLFRPDSFYGESLAQEVVKRFRERKLLYLRPKKVSFDSRGY
LERMGITLKDQILYETRCRDYTPEEAPEPGSVIVFTSPSTIHCFLENFAWRDDYHAVVIG
RSTLAHLPEGPSFSVAEEPTIAACIARARQWAEILPDTK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccccaggatctatctcacctctcccgtggagtatcccggaacaatccccctgccg
atgatccgattcgctctcgtcgccgaccgtatcgattatcaggggtgcgatacgctgatg
ttcacttccaagcaggcggtactgagtgccgaagcgatcgatcccgattggaaacgcctg
cccgccatcgccatcggtcccgctacccagcgccagatcgaaacgctcgggggagaggta
ctttttcgccccgactccttctacggtgagagtttggcccaggaggtcgtcaaacgtttt
cgggaacggaaactcctctaccttcgtcccaaaaaggtctcctttgacagccgggggtat
ctggagcgtatggggattacgctcaaggatcagatcctctatgagacccgctgccgggac
tatacgcccgaggaggccccggagcccggatcggtcatcgttttcacctctccctcgacc
atccactgcttcttggaaaacttcgcctggcgggatgattatcacgccgtggtgatcggc
cgttcgacccttgctcatctgcccgaagggccctctttttccgtggccgaggagccgacg
atcgccgcgtgcatcgcccgggcgcgccaatgggcggaaatcttgcctgatactaaatga

DBGET integrated database retrieval system