KEGG   Nitratifractor salsuginis: Nitsa_0466Help
Entry
Nitsa_0466        CDS       T01405                                 

Definition
DNA replication and repair protein recr
Orthology
K06187  
recombination protein RecR
Organism
nsa  Nitratifractor salsuginis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Nitsa_0466
DNA repair and recombination proteins [BR:nsa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Nitsa_0466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
477702..478271
Genome map
AA seq 189 aa AA seqDB search
MKRYRVESFERLVEAFNALPTIGRKTATRLAYHLVTEQGFSGLKLAQAIEDAVSSLRTCR
RCHAICEDELCGICSDPGRDRSKLCIVQSAKDIFTIEESGQYEGLYYILSSIEELDESHL
HEIVEGVEEVIFAFPPGIATDTMILYIEDRLSDRGLVFTKIAQGVPTGVELDNIDLLSLS
RALEDRVRV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtatagagtcgaatctttcgaacggctggttgaagccttcaatgctctgccg
accatcgggcgcaagacggcgacacgcctggcctatcatctggtgacggagcagggcttc
agcgggctcaagctcgcccaggcgatcgaggatgcggtgagtagcctcagaacgtgccgg
cgttgtcacgcgatctgcgaagatgagctctgcgggatctgcagcgatccgggccgggac
cggagcaagctctgtatcgtccaaagcgccaaggatatctttaccatcgaagaatcgggg
cagtacgagggactctactatatcctctcttccatcgaagagctggatgagagccacctg
cacgagatcgtggagggggtggaggaggtgatcttcgccttccctcccgggatcgccacc
gatacgatgatcctctatatcgaggatcgtctgagtgaccggggcttggtctttaccaag
atcgcccagggagttcccaccggcgtggagttggacaacatcgatctgctctccctctcc
cgggccctggaagaccgggtgcgcgtctag

DBGET integrated database retrieval system