KEGG   Nitratifractor salsuginis: Nitsa_0466Help
Entry
Nitsa_0466        CDS       T01405                                 

Definition
DNA replication and repair protein recr
Orthology
K06187  
recombination protein RecR
Organism
nsa  Nitratifractor salsuginis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nsa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
477702..478271
Genome map
AA seq 189 aa AA seqDB search
MKRYRVESFERLVEAFNALPTIGRKTATRLAYHLVTEQGFSGLKLAQAIEDAVSSLRTCR
RCHAICEDELCGICSDPGRDRSKLCIVQSAKDIFTIEESGQYEGLYYILSSIEELDESHL
HEIVEGVEEVIFAFPPGIATDTMILYIEDRLSDRGLVFTKIAQGVPTGVELDNIDLLSLS
RALEDRVRV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtatagagtcgaatctttcgaacggctggttgaagccttcaatgctctgccg
accatcgggcgcaagacggcgacacgcctggcctatcatctggtgacggagcagggcttc
agcgggctcaagctcgcccaggcgatcgaggatgcggtgagtagcctcagaacgtgccgg
cgttgtcacgcgatctgcgaagatgagctctgcgggatctgcagcgatccgggccgggac
cggagcaagctctgtatcgtccaaagcgccaaggatatctttaccatcgaagaatcgggg
cagtacgagggactctactatatcctctcttccatcgaagagctggatgagagccacctg
cacgagatcgtggagggggtggaggaggtgatcttcgccttccctcccgggatcgccacc
gatacgatgatcctctatatcgaggatcgtctgagtgaccggggcttggtctttaccaag
atcgcccagggagttcccaccggcgtggagttggacaacatcgatctgctctccctctcc
cgggccctggaagaccgggtgcgcgtctag

DBGET integrated database retrieval system