KEGG   Nitratifractor salsuginis: Nitsa_0576Help
Entry
Nitsa_0576        CDS       T01405                                 

Definition
ATP citrate lyase subunit 1 (EC:2.3.3.8)
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
nsa  Nitratifractor salsuginis
Pathway
Citrate cycle (TCA cycle)
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nitsa_0576
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nitsa_0576
Enzymes [BR:nsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     Nitsa_0576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
580284..581603
Genome map
AA seq 439 aa AA seqDB search
MAQRAIREYDGKQLFAKHWNEYFDGFHYPFKSVLVTSADELRQKAKEHGFEWLNQEPLVV
KPDMLFGKRGKNDLVLFKKEKPGDVTLEDAAKWIEEKQSHDVTLLSGQHGRLTHFIVEPF
TPHTQDQEYYIAATTVGEDDVLYMSAEGGMEVEEGWEEKVNEVRIPINMPEADIEKAIRA
NVPEDIPAESHEAFATFAIQFFKFFRDMHFAYLEINPLVLIGTDAHILDLVARLDDTAGF
MMKEKWGDIEFPTAFGMEEQSPEEKAIAEADSKSGASLKLTVLNPQGRIWTMVAGGGASV
VYADTIADLAGVKDLANYGEYSGGPTTGETEFYAETIFDLMTRYPDPRGKILIIGGAIAN
FTDVAKTFTGIINALEKWAPKLKEHNTKIYVRRGGPNYEKGLQDMKDAAERLGLEIHVYG
PETHVTDIVRMALEDEKQK
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggctcaacgagcaatacgcgaatatgatggaaagcagctctttgccaaacattggaat
gagtatttcgacgggttccactaccccttcaagtccgtgctggtcaccagcgccgacgaa
ctccgccaaaaggcgaaagagcacggattcgagtggctcaaccaggagcccctggtcgtc
aaacccgatatgctcttcggtaagcgcggtaaaaacgatctggtccttttcaaaaaagag
aagcccggtgacgtgaccctcgaagatgccgccaaatggatcgaagagaagcagtcccat
gacgtcacgctgctttccggtcagcatggccgcctgacccacttcatcgtcgagcctttt
accccccacacccaggatcaggagtactacatcgccgccaccaccgtcggtgaggacgat
gtgctctatatgtccgccgaagggggaatggaagtcgaagagggatgggaagagaaagtc
aacgaagtccgcatccccatcaatatgcccgaagcggacatcgaaaaggcgatccgcgcc
aacgtgcctgaggatattccggccgagagccatgaagccttcgccactttcgccatccag
ttcttcaaattcttccgggatatgcacttcgcctacctggagatcaacccgctggtcctc
atcggtaccgacgctcatatccttgacctcgttgcccgtctggatgataccgccggcttt
atgatgaaagagaagtggggagacatcgaattccccaccgccttcggtatggaagagcag
tctcccgaagagaaagccatcgccgaagccgacagcaagtcgggtgcgtcactcaagctc
accgtcctcaacccccagggccgcatctggaccatggtcgccggaggaggcgcttccgtc
gtctatgccgacaccatcgccgatttggcaggggtcaaggacctggccaactacggggag
tactccggaggacccaccaccggggagaccgagttctacgccgagaccatcttcgacctg
atgacccgctatcccgaccccagaggcaagatcctcatcatcggaggggccattgccaac
ttcaccgatgtcgccaagaccttcaccgggatcatcaacgccctggagaaatgggcgccc
aagctcaaagagcacaacaccaagatctatgtacgccggggcggccccaactatgaaaaa
gggcttcaggatatgaaagatgctgcggagcgcctgggtctggagatccatgtctacggt
cccgaaactcacgtcaccgacatcgtgcgcatggccctcgaagacgagaagcagaagtaa

DBGET integrated database retrieval system