KEGG   Nitratifractor salsuginis: Nitsa_0576Help
Entry
Nitsa_0576        CDS       T01405                                 

Definition
(GenBank) ATP citrate lyase subunit 1
  KO
K15231  ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
nsa  Nitratifractor salsuginis
Pathway
nsa00020  Citrate cycle (TCA cycle)
nsa01100  Metabolic pathways
nsa01110  Biosynthesis of secondary metabolites
nsa01120  Microbial metabolism in diverse environments
nsa01130  Biosynthesis of antibiotics
nsa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nitsa_0576
Enzymes [BR:nsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     Nitsa_0576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_bind ATP-grasp_2
Motif
Other DBs
NCBI-ProteinID: ADV45844
UniProt: E6X141
Position
580284..581603
Genome map
AA seq 439 aa AA seqDB search
MAQRAIREYDGKQLFAKHWNEYFDGFHYPFKSVLVTSADELRQKAKEHGFEWLNQEPLVV
KPDMLFGKRGKNDLVLFKKEKPGDVTLEDAAKWIEEKQSHDVTLLSGQHGRLTHFIVEPF
TPHTQDQEYYIAATTVGEDDVLYMSAEGGMEVEEGWEEKVNEVRIPINMPEADIEKAIRA
NVPEDIPAESHEAFATFAIQFFKFFRDMHFAYLEINPLVLIGTDAHILDLVARLDDTAGF
MMKEKWGDIEFPTAFGMEEQSPEEKAIAEADSKSGASLKLTVLNPQGRIWTMVAGGGASV
VYADTIADLAGVKDLANYGEYSGGPTTGETEFYAETIFDLMTRYPDPRGKILIIGGAIAN
FTDVAKTFTGIINALEKWAPKLKEHNTKIYVRRGGPNYEKGLQDMKDAAERLGLEIHVYG
PETHVTDIVRMALEDEKQK
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggctcaacgagcaatacgcgaatatgatggaaagcagctctttgccaaacattggaat
gagtatttcgacgggttccactaccccttcaagtccgtgctggtcaccagcgccgacgaa
ctccgccaaaaggcgaaagagcacggattcgagtggctcaaccaggagcccctggtcgtc
aaacccgatatgctcttcggtaagcgcggtaaaaacgatctggtccttttcaaaaaagag
aagcccggtgacgtgaccctcgaagatgccgccaaatggatcgaagagaagcagtcccat
gacgtcacgctgctttccggtcagcatggccgcctgacccacttcatcgtcgagcctttt
accccccacacccaggatcaggagtactacatcgccgccaccaccgtcggtgaggacgat
gtgctctatatgtccgccgaagggggaatggaagtcgaagagggatgggaagagaaagtc
aacgaagtccgcatccccatcaatatgcccgaagcggacatcgaaaaggcgatccgcgcc
aacgtgcctgaggatattccggccgagagccatgaagccttcgccactttcgccatccag
ttcttcaaattcttccgggatatgcacttcgcctacctggagatcaacccgctggtcctc
atcggtaccgacgctcatatccttgacctcgttgcccgtctggatgataccgccggcttt
atgatgaaagagaagtggggagacatcgaattccccaccgccttcggtatggaagagcag
tctcccgaagagaaagccatcgccgaagccgacagcaagtcgggtgcgtcactcaagctc
accgtcctcaacccccagggccgcatctggaccatggtcgccggaggaggcgcttccgtc
gtctatgccgacaccatcgccgatttggcaggggtcaaggacctggccaactacggggag
tactccggaggacccaccaccggggagaccgagttctacgccgagaccatcttcgacctg
atgacccgctatcccgaccccagaggcaagatcctcatcatcggaggggccattgccaac
ttcaccgatgtcgccaagaccttcaccgggatcatcaacgccctggagaaatgggcgccc
aagctcaaagagcacaacaccaagatctatgtacgccggggcggccccaactatgaaaaa
gggcttcaggatatgaaagatgctgcggagcgcctgggtctggagatccatgtctacggt
cccgaaactcacgtcaccgacatcgtgcgcatggccctcgaagacgagaagcagaagtaa

DBGET integrated database retrieval system