KEGG   Nitratifractor salsuginis: Nitsa_0611Help
Entry
Nitsa_0611        CDS       T01405                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nsa  Nitratifractor salsuginis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nitsa_0611
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nitsa_0611
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nitsa_0611
Enzymes [BR:nsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Nitsa_0611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(616065..617282)
Genome map
AA seq 405 aa AA seqDB search
MSQSHDVYIPTPSPFDPDELGHFGIFGGRYVPETLMPVLESLKKDYEAVRFDPEFWKEVD
YYYKNYVGRPSALYFAENLSKEIGARIYLKREDLNHTGAHKINHTVAQAILAKRLGKKKI
IAETGAGQHGVATATVAALFGLECEIFMGAKDVARQELNVFRMKLLGAKVHAVQSGSKTL
KDAMNDAIRHWVTHARDTFYVIGTVAGPHPYPMMIRDIQSIIGWEAKRQILEAEGRLPDK
VIACIGGGSNAIGIFNHFLEEEQTECIGIEAGGLGLDSKHGASLAKGAPGVLHGQMSYLL
QDEDGQILEAHSISAGLDYPGIGPEHAWLKELGRVTYDNITDQEALDAFVWLSQKEGIIP
AFESSHAVAYLKKMNPEELRGKLVLINLSGRGDKDMIQAKELLEF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtcacacgatgtttatatccccaccccttccccctttgacccggatgaactg
ggccacttcggaatcttcggcggacgctatgtccccgaaaccctgatgccggtcctggag
tccctcaaaaaagattacgaagcggtccgcttcgatcccgaattctggaaagaggtggac
tactactacaaaaactacgtcggccgccccagcgccctctacttcgccgaaaacctctca
aaagagatcggcgcgcggatctacctcaagcgcgaagacctcaaccacacgggcgcgcac
aagatcaaccacaccgtcgcccaggcgatcctggccaagcggctgggcaaaaagaagatc
atcgccgagacgggcgcaggccagcacggggtggccaccgccaccgtcgccgccctgttt
ggcctggagtgcgaaattttcatgggagccaaggacgtcgcccgccaggagctcaacgtc
ttccggatgaagctcctgggcgccaaggtccacgccgtgcagagcggctccaagaccctc
aaagacgctatgaacgacgccatccgccattgggtcacccacgcccgggataccttctac
gtcatcggtaccgtcgccggcccccacccctatccgatgatgattcgggatatccagagc
atcatcggctgggaagccaaacgccagatcctcgaagccgaaggacgcctgcctgacaag
gtgattgcctgcatcggcgggggttccaacgccatcgggatcttcaaccatttcctcgaa
gaggagcaaactgagtgcatcggcatcgaagcgggcggcctggggctcgactccaagcac
ggcgccagcctcgccaagggggctccgggcgtgctccacggccagatgagctacctgctc
caggacgaggacggccagatcctcgaagcccactccatcagcgccgggctggattacccc
ggcatcggccccgagcacgcctggctcaaagagctcggccgcgtcacctacgacaacatc
accgaccaggaagccctcgacgccttcgtctggctcagccaaaaagaggggatcatcccc
gccttcgagagctcccacgctgttgcctacctcaaaaagatgaatcccgaagaactccgg
ggcaagctcgtgctcatcaacctctcgggacggggggacaaggatatgatccaggcgaag
gaacttttggagttctga

DBGET integrated database retrieval system