KEGG   Nitratifractor salsuginis: Nitsa_0627Help
Entry
Nitsa_0627        CDS       T01405                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nsa  Nitratifractor salsuginis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Nitsa_0627
   00052 Galactose metabolism
    Nitsa_0627
   00500 Starch and sucrose metabolism
    Nitsa_0627
   00520 Amino sugar and nucleotide sugar metabolism
    Nitsa_0627
Enzymes [BR:nsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Nitsa_0627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
632934..633761
Genome map
AA seq 275 aa AA seqDB search
MIRKCLFPAAGYGTRFLPATKATPKEMLPILTKPLIQYGVEEALAAGIHTMAIVTGRGKR
AIEDHFDISYELEHQIKGTSKEPLLREIRDVIEHCTFSYTRQKEMKGLGHAILTGETLIG
QEPFAVILADDLCDHEEGDPVLKQMVELFNRFRCSIVAIEEVPADQTHKYGIIAGEEIEE
GIYRVQNMVEKPDPKKAPSNLAIIGRYILTPDIFDKIRRTKPGKGGEIQITDALLKQAGE
GRVIAYRFKGRRFDCGSVDGFVEATNHFYEKYRAK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgatccgaaaatgcctcttcccggcggcgggctacgggacccgctttctgccggcgacc
aaagcgacccccaaagagatgcttcccatcctgaccaagcctctgatccagtatggagtc
gaagaggccctggcggcggggattcacacgatggctatcgtcaccggccggggcaagcgc
gccatcgaagaccatttcgatatctcctacgagctggagcatcagatcaaagggacgagc
aaagagccccttcttcgtgaaattcgtgacgtgatcgagcattgtaccttctcctatacc
cgacaaaaagagatgaaagggttgggacacgccattctcaccggagagaccctgattggt
caggaaccctttgccgtgatcctggccgatgacctttgtgatcacgaggaaggggatccg
gtcctcaagcagatggtggagcttttcaaccgttttcgatgctccatcgtcgccatcgaa
gaggttcctgccgatcagacccacaaatacggcattatcgccggcgaagagatcgaagag
gggatctatcgtgtgcagaatatggtggagaagcccgaccccaaaaaggccccaagcaac
ctggccattatcggccgctacatccttactcccgacatttttgacaaaatacgccgaacg
aagcccggcaaaggaggggagatccaaatcaccgatgctttgctcaagcaagcgggtgag
ggaagggtgatcgcctaccgtttcaaaggcagacgtttcgattgcggatcggtggacgga
ttcgtggaagcgacgaaccacttttatgagaagtaccgggctaagtag

DBGET integrated database retrieval system