KEGG   Nitratifractor salsuginis: Nitsa_0641Help
Entry
Nitsa_0641        CDS       T01405                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
nsa  Nitratifractor salsuginis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nsa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
645521..646663
Genome map
AA seq 380 aa AA seqDB search
MELYRIGIVRERKRVLRELGVESGGVKIMAEKMQTLWIKIRRLRTPAANILKQDALSIGA
DLAVPSGVITCETEYVDALLIATRAQLRTLARKERAQPFGLKRLAGELEGFLNEPGEPVK
IMGVLNANEDSFYAGSRFLGEAAVERIEAMIGEGAAIIDIGGVSSRPGSEPVSAEEELER
VRPICEALERSGLTEKALFSIDSYTPAVVEYALQKGFGLINDITGATDERIIALAKAYQA
RLCIMHMQGTPQTMQLDPHYEDVTAEVDAFFTERIEACEAAGLSRDQLILDVGIGFGKTL
EHNLELLRNHANFLRHGCELLIGASRKSMIDRIIPTPTEARLPGTLAIHLKAVENGATIV
RCHDVAEHRQALAVWEAIGL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggagctttatcggatcggaatcgtacgggaacgcaagcgggtcctccgggaactcggt
gtcgagagcggcggggtgaagattatggcggagaagatgcagaccctctggatcaagatc
cgccgtctgcgcacacccgccgccaacatcctcaagcaggatgccctgagtatcggcgcc
gacctggcggtgccgagcggtgtgatcacctgcgagacggagtatgtggatgccctgctc
atcgctacccgcgcccaattgcggaccttggctcgcaaagagcgggcccaacccttcggc
ctgaagcgtctggcgggggagttggagggctttttgaatgagcccggagagccggtgaag
attatgggggtcctcaatgccaacgaggacagcttttacgccggaagccgctttctgggt
gaggcggccgttgagaggatcgaggcgatgatcggggagggcgcggcgatcatcgacatc
ggcggcgtctcctcccgccccggatcggagccggtctctgccgaagaggagctggaacgg
gtgcgccccatctgtgaggcgctcgagcgctcaggcctgacggagaaagccctcttcagt
atcgacagctatacccctgcggtggtggagtatgctctccaaaaaggcttcggcctcatc
aacgatatcaccggcgcgacggatgagcgcattatcgccctggccaaggcttaccaggcg
cggctctgcattatgcatatgcagggcaccccccagacgatgcagctcgatccccactac
gaggatgtgaccgccgaggtggatgcctttttcaccgagcggatcgaagcgtgcgaagcg
gcgggcctgtcgagagatcagttgatcttggatgtggggatcggtttcggcaaaaccctg
gagcacaatctggaacttctgcgcaaccacgccaatttcctgcgccacggatgcgaactg
ctcatcggcgcgagtcgcaaatcgatgatcgacaggatcatccccacccccaccgaagcc
cgtctgcccgggactttggctatccatctcaaagcggtggagaacggcgccaccattgtc
cgttgtcacgacgtggccgagcatcggcaggccttggcggtttgggaagcgataggactt
tga

DBGET integrated database retrieval system