KEGG   Nitratifractor salsuginis: Nitsa_0641Help
Entry
Nitsa_0641        CDS       T01405                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
nsa  Nitratifractor salsuginis
Pathway
nsa00790  Folate biosynthesis
nsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Nitsa_0641
Enzymes [BR:nsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Nitsa_0641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ADV45909
UniProt: E6X1H6
Position
645521..646663
Genome map
AA seq 380 aa AA seqDB search
MELYRIGIVRERKRVLRELGVESGGVKIMAEKMQTLWIKIRRLRTPAANILKQDALSIGA
DLAVPSGVITCETEYVDALLIATRAQLRTLARKERAQPFGLKRLAGELEGFLNEPGEPVK
IMGVLNANEDSFYAGSRFLGEAAVERIEAMIGEGAAIIDIGGVSSRPGSEPVSAEEELER
VRPICEALERSGLTEKALFSIDSYTPAVVEYALQKGFGLINDITGATDERIIALAKAYQA
RLCIMHMQGTPQTMQLDPHYEDVTAEVDAFFTERIEACEAAGLSRDQLILDVGIGFGKTL
EHNLELLRNHANFLRHGCELLIGASRKSMIDRIIPTPTEARLPGTLAIHLKAVENGATIV
RCHDVAEHRQALAVWEAIGL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggagctttatcggatcggaatcgtacgggaacgcaagcgggtcctccgggaactcggt
gtcgagagcggcggggtgaagattatggcggagaagatgcagaccctctggatcaagatc
cgccgtctgcgcacacccgccgccaacatcctcaagcaggatgccctgagtatcggcgcc
gacctggcggtgccgagcggtgtgatcacctgcgagacggagtatgtggatgccctgctc
atcgctacccgcgcccaattgcggaccttggctcgcaaagagcgggcccaacccttcggc
ctgaagcgtctggcgggggagttggagggctttttgaatgagcccggagagccggtgaag
attatgggggtcctcaatgccaacgaggacagcttttacgccggaagccgctttctgggt
gaggcggccgttgagaggatcgaggcgatgatcggggagggcgcggcgatcatcgacatc
ggcggcgtctcctcccgccccggatcggagccggtctctgccgaagaggagctggaacgg
gtgcgccccatctgtgaggcgctcgagcgctcaggcctgacggagaaagccctcttcagt
atcgacagctatacccctgcggtggtggagtatgctctccaaaaaggcttcggcctcatc
aacgatatcaccggcgcgacggatgagcgcattatcgccctggccaaggcttaccaggcg
cggctctgcattatgcatatgcagggcaccccccagacgatgcagctcgatccccactac
gaggatgtgaccgccgaggtggatgcctttttcaccgagcggatcgaagcgtgcgaagcg
gcgggcctgtcgagagatcagttgatcttggatgtggggatcggtttcggcaaaaccctg
gagcacaatctggaacttctgcgcaaccacgccaatttcctgcgccacggatgcgaactg
ctcatcggcgcgagtcgcaaatcgatgatcgacaggatcatccccacccccaccgaagcc
cgtctgcccgggactttggctatccatctcaaagcggtggagaacggcgccaccattgtc
cgttgtcacgacgtggccgagcatcggcaggccttggcggtttgggaagcgataggactt
tga

DBGET integrated database retrieval system