KEGG   Nitratifractor salsuginis: Nitsa_0742Help
Entry
Nitsa_0742        CDS       T01405                                 

Definition
holliday junction DNA helicase subunit ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
nsa  Nitratifractor salsuginis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Nitsa_0742
Enzymes [BR:nsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Nitsa_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
749550..750113
Genome map
AA seq 187 aa AA seqDB search
MIVGIEGKVEAREPTWLHLNVGGLIYEVNVSLNTSNTVAGKEQVKLYVTQIIREDANLLF
GFADRNEKKMFDTLLKINGVGPKVAQAVCSTFTPESFAKIVAAKDVALLKRVPGIGPKAA
SRILVELADFIVDGSTAEGSAAADHQEAVMALESLGFKKEAIRKALAGESGDTATLVKAA
LKKLQRL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtgggaattgaaggaaaagtggaagccagagagccgacctggcttcatctcaat
gtgggcggcctgatctatgaggtgaatgtctctctcaatacctccaacaccgttgcgggc
aaggagcaggtgaagctctacgtcacccagatcatccgggaggatgcgaatctcctcttc
ggtttcgccgaccggaacgagaagaagatgtttgacaccctgctcaagatcaacggtgtg
gggcccaaggtggctcaggcggtctgctccaccttcacccccgagagcttcgccaagatc
gtcgccgccaaagacgtggcactgctcaaaagagtccccggcatcggtcccaaagcggcc
agccggatcctggtggaattggccgacttcatcgtcgacggttctaccgccgaggggagt
gccgcggccgatcatcaggaggcggtcatggccctggagagcctgggcttcaagaaagag
gcgatccgcaaagccctggcgggagagagcggcgacaccgccactctggtcaaggcggcg
ctgaagaagttgcagagactttga

DBGET integrated database retrieval system