KEGG   Nitratifractor salsuginis: Nitsa_0994Help
Entry
Nitsa_0994        CDS       T01405                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nsa  Nitratifractor salsuginis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nitsa_0994
   01230 Biosynthesis of amino acids
    Nitsa_0994
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nitsa_0994
  Energy metabolism
   00680 Methane metabolism
    Nitsa_0994
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nitsa_0994
Enzymes [BR:nsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Nitsa_0994
Exosome [BR:nsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Nitsa_0994
  Exosomal proteins of melanoma cells
   Nitsa_0994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1004453..1005142
Genome map
AA seq 229 aa AA seqDB search
MGKLILLRHGQSVYNLQNIFTGWTDVALSEKGIAEAQKAGQILKAHNLLPDLCFTSWLKR
AIHTAQLALRELDWEQIDCIKSWKLNERHYGAWQQRNKDEVKEEVGEERFIAIRRGYDTP
PPPLPDGDPRLPENDPKFRLIDPSHLPRSESLKDTRRRTLNYFYEAIAPQLARDKTVLVS
AHGNSLRALTMAIEQLSPEEIVKVEIPTGQPILYRFDETLEMLEKKVLS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaactgatcctgctgcgtcacggacagagtgtctacaatcttcaaaatatcttc
accggctggaccgatgtggcgttgagcgaaaaggggatcgccgaagcccaaaaggcgggg
cagatcctcaaagcccacaatctcctgcccgatctctgcttcacctcctggctcaaacgg
gcgatccataccgcccagctggccctcagagaactggattgggagcagatcgactgcatc
aaatcctggaagctcaacgagcgtcactacggcgcctggcagcaacgcaacaaggacgag
gtgaaagaggaggtgggcgaagagagattcatcgccatccgccgtggctacgatacgcct
ccgccgccactgcccgacggtgatccacgactgccggaaaatgaccctaaattccgcctg
atcgatccgtcacatctgccccgcagcgaatccctcaaggatacccgccgccggacgctt
aactacttttacgaagcgatcgctccccagttggcacgggacaaaaccgtcctggtcagc
gcccacggcaattccctgagggcgctgacgatggcgatcgaacagctgagcccggaagag
atcgtcaaagtggagattcccacgggccagccgatcctctaccgcttcgacgagaccctg
gagatgctggagaaaaaggtgctctcttga

DBGET integrated database retrieval system