KEGG   Nitratifractor salsuginis: Nitsa_0998Help
Entry
Nitsa_0998        CDS       T01405                                 

Definition
biotin/lipoyl attachment domain-containing protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nsa  Nitratifractor salsuginis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nitsa_0998
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nitsa_0998
   00020 Citrate cycle (TCA cycle)
    Nitsa_0998
   00620 Pyruvate metabolism
    Nitsa_0998
Enzymes [BR:nsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Nitsa_0998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1007517..1009001
Genome map
AA seq 494 aa AA seqDB search
MAYEIVMPQLSDSMTEGKLISWKVKPGDKVKVGDTIAEVESDKAIMEVQTFHDGIVRELK
VKEGESAPVGSVIAVIEETSDNEQQRNEQPSNRATEQPVKTAPSNEELGTRNEERNNRVT
EQPSNEQPMKAAPSNEELGMRNEESKPSVSSEQSKDAKASKSNDQRPTTNDRSSQRSKSI
VDELFSNETPVSEKTPHSSLLTPHSREAIASPRARALAARYGLDLEKLQKKGELPTPAHA
EDIERYRQRKYFTPKAWKLVEEYQLDPALFDSGKKHNEEEIKAYIEAHEIPRPKPLSSNQ
KAVIATVEQAAKTPVYHIYDHIDASLILQHESDELTVTVWLLKLLSETMMRHEVLRSTLG
PQGIQIWPNASISLAIAKGEELYMPVLKDLNKMSPKEITDALKAMKEKVKERRLSPQDMR
GSTFGLSNLGMTGIERFDAMINGTDSGIAAIGSTIDGKIAVTFTLDHRLVNGLQGAQAME
TLKTLAKDEMIFKG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgagatcgtcatgccccaactctccgactccatgaccgaggggaagctgatc
agctggaaggtcaagccgggagacaaagtcaaagtaggtgacaccatcgccgaagtcgaa
agcgacaaagcaatcatggaggttcagacttttcacgacggcatcgtcagagagctcaag
gtcaaagagggggagagcgcaccggtcgggagtgtcatcgcagtgatcgaagaaacctct
gacaatgaacaacagaggaatgagcaaccgagcaaccgagcaaccgagcaaccggtgaag
actgcgccttcaaatgaggaattaggaacgaggaatgaggaacggaataaccgagtaacc
gagcaaccgagcaatgagcaaccgatgaaggctgcgccttcaaatgaggaattaggaatg
aggaatgaggaatcgaaaccttcggtttcgagtgagcagtcaaaggacgcgaaagcatcc
aaatccaacgaccaacgaccaacgaccaacgaccgatcctctcaacgctcaaaatccatc
gtcgacgagctcttcagcaacgaaactccagtttctgaaaaaacgcctcactcctcactc
ctcactcctcactcgcgcgaagcgatcgcttcgccgagggcccgcgccctggccgcccgc
tacggactcgacctcgagaagctccagaaaaaaggagagctccccactcccgcccatgcc
gaggatatcgaacgctaccgtcagcgcaaatacttcacccccaaagcctggaaactcgtg
gaagagtatcagctcgacccggcacttttcgacagcgggaagaaacataacgaagaggag
atcaaagcttacatcgaagcgcacgagatccccaggcccaagcctctgagttccaaccag
aaggcggtcatcgctacggtggagcaggcagcgaaaacaccggtctatcatatctacgac
catatcgacgcttcgctcatccttcagcacgagagcgatgagctcaccgtcaccgtctgg
cttctcaagcttctgagcgaaacgatgatgcgccacgaagtcctgcgctcgaccctcggt
ccccaggggatccagatctggcccaacgcctccatctccctggccatagccaaaggggaa
gagctctatatgccggtcctgaaagatttgaacaaaatgagccccaaagagatcaccgac
gcgctcaaggcgatgaaagagaaggtcaaagagagaaggctgagcccccaggatatgcgc
ggctccaccttcggtctgagcaacctggggatgaccgggatcgaacgtttcgatgcgatg
atcaatggaaccgacagcggtattgccgccataggcagcaccatcgacggcaagatcgcc
gtcaccttcaccctcgatcacagattggtcaatggtttgcagggtgcccaggcgatggag
acgcttaagactttggcgaaggatgagatgatttttaaaggctga

DBGET integrated database retrieval system