KEGG   Nitratifractor salsuginis: Nitsa_0998Help
Entry
Nitsa_0998        CDS       T01405                                 

Definition
(GenBank) biotin/lipoyl attachment domain-containing protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nsa  Nitratifractor salsuginis
Pathway
nsa00010  Glycolysis / Gluconeogenesis
nsa00020  Citrate cycle (TCA cycle)
nsa00620  Pyruvate metabolism
nsa01100  Metabolic pathways
nsa01110  Biosynthesis of secondary metabolites
nsa01120  Microbial metabolism in diverse environments
nsa01130  Biosynthesis of antibiotics
nsa01200  Carbon metabolism
Module
nsa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nitsa_0998
   00020 Citrate cycle (TCA cycle)
    Nitsa_0998
   00620 Pyruvate metabolism
    Nitsa_0998
Enzymes [BR:nsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Nitsa_0998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H Peptidase_M23 PTS_EIIA_1 PYNP_C ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: ADV46257
UniProt: E6X3I0
Position
1007517..1009001
Genome map
AA seq 494 aa AA seqDB search
MAYEIVMPQLSDSMTEGKLISWKVKPGDKVKVGDTIAEVESDKAIMEVQTFHDGIVRELK
VKEGESAPVGSVIAVIEETSDNEQQRNEQPSNRATEQPVKTAPSNEELGTRNEERNNRVT
EQPSNEQPMKAAPSNEELGMRNEESKPSVSSEQSKDAKASKSNDQRPTTNDRSSQRSKSI
VDELFSNETPVSEKTPHSSLLTPHSREAIASPRARALAARYGLDLEKLQKKGELPTPAHA
EDIERYRQRKYFTPKAWKLVEEYQLDPALFDSGKKHNEEEIKAYIEAHEIPRPKPLSSNQ
KAVIATVEQAAKTPVYHIYDHIDASLILQHESDELTVTVWLLKLLSETMMRHEVLRSTLG
PQGIQIWPNASISLAIAKGEELYMPVLKDLNKMSPKEITDALKAMKEKVKERRLSPQDMR
GSTFGLSNLGMTGIERFDAMINGTDSGIAAIGSTIDGKIAVTFTLDHRLVNGLQGAQAME
TLKTLAKDEMIFKG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgagatcgtcatgccccaactctccgactccatgaccgaggggaagctgatc
agctggaaggtcaagccgggagacaaagtcaaagtaggtgacaccatcgccgaagtcgaa
agcgacaaagcaatcatggaggttcagacttttcacgacggcatcgtcagagagctcaag
gtcaaagagggggagagcgcaccggtcgggagtgtcatcgcagtgatcgaagaaacctct
gacaatgaacaacagaggaatgagcaaccgagcaaccgagcaaccgagcaaccggtgaag
actgcgccttcaaatgaggaattaggaacgaggaatgaggaacggaataaccgagtaacc
gagcaaccgagcaatgagcaaccgatgaaggctgcgccttcaaatgaggaattaggaatg
aggaatgaggaatcgaaaccttcggtttcgagtgagcagtcaaaggacgcgaaagcatcc
aaatccaacgaccaacgaccaacgaccaacgaccgatcctctcaacgctcaaaatccatc
gtcgacgagctcttcagcaacgaaactccagtttctgaaaaaacgcctcactcctcactc
ctcactcctcactcgcgcgaagcgatcgcttcgccgagggcccgcgccctggccgcccgc
tacggactcgacctcgagaagctccagaaaaaaggagagctccccactcccgcccatgcc
gaggatatcgaacgctaccgtcagcgcaaatacttcacccccaaagcctggaaactcgtg
gaagagtatcagctcgacccggcacttttcgacagcgggaagaaacataacgaagaggag
atcaaagcttacatcgaagcgcacgagatccccaggcccaagcctctgagttccaaccag
aaggcggtcatcgctacggtggagcaggcagcgaaaacaccggtctatcatatctacgac
catatcgacgcttcgctcatccttcagcacgagagcgatgagctcaccgtcaccgtctgg
cttctcaagcttctgagcgaaacgatgatgcgccacgaagtcctgcgctcgaccctcggt
ccccaggggatccagatctggcccaacgcctccatctccctggccatagccaaaggggaa
gagctctatatgccggtcctgaaagatttgaacaaaatgagccccaaagagatcaccgac
gcgctcaaggcgatgaaagagaaggtcaaagagagaaggctgagcccccaggatatgcgc
ggctccaccttcggtctgagcaacctggggatgaccgggatcgaacgtttcgatgcgatg
atcaatggaaccgacagcggtattgccgccataggcagcaccatcgacggcaagatcgcc
gtcaccttcaccctcgatcacagattggtcaatggtttgcagggtgcccaggcgatggag
acgcttaagactttggcgaaggatgagatgatttttaaaggctga

DBGET integrated database retrieval system