KEGG   Nitratifractor salsuginis: Nitsa_1009Help
Entry
Nitsa_1009        CDS       T01405                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nsa  Nitratifractor salsuginis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nitsa_1009
   01230 Biosynthesis of amino acids
    Nitsa_1009
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nitsa_1009
   00030 Pentose phosphate pathway
    Nitsa_1009
   00051 Fructose and mannose metabolism
    Nitsa_1009
   00052 Galactose metabolism
    Nitsa_1009
  Energy metabolism
   00680 Methane metabolism
    Nitsa_1009
Enzymes [BR:nsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Nitsa_1009
Protein phosphatases and associated proteins [BR:nsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Nitsa_1009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1019353..1020312
Genome map
AA seq 319 aa AA seqDB search
MALAIMGSGGDAPGMNAAVKKFVDYLYDRGETPHLIYDGLEGLIDGKIKKAEHKDVAGIL
HRGGCVIRSSRSKRFYDYEYRKQAYENLQKNGIDGLVVLGGDGSFRAMDVFSKEFPVNFV
GIPTTIDNDIYGTDYCLGVDTALNTIRDALDKIYDTASTFNRAFVVEVMGRECGYLAVIS
AMGSGAEVCVIPEVAFNRPVAEARLKREIANGRNYILAIVAEGTKKTQEIAEWIEKDLGF
ETRVTVLGHIQRGGAPSSYDRLMAFEFAVRAVDHLLESQRSNKVVVYQNGHFDLLEIDTV
VSNKYQLNPRHLAMLNILD
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcactggcgataatgggatcggggggagacgcccccggaatgaatgcggcggtcaag
aagttcgtcgattatctttacgaccggggggagacgccccatttgatctacgacggcctg
gaagggctcatcgacggcaagatcaaaaaggccgagcacaaagatgtggcggggattctc
caccggggagggtgcgtcatccgctcctcacgctcgaaacgcttctatgattacgagtac
cgcaaacaggcttacgaaaacctgcagaagaacggtatcgacggattggtcgtcctgggg
ggagacggctccttccgggctatggatgtcttcagcaaggagtttccggtcaatttcgtc
ggcattcccacgaccatcgacaacgatatctacggcaccgactactgcctgggggtcgat
acggctctgaacacaatccgtgatgctctcgacaagatctacgacaccgcttcgaccttc
aaccgggccttcgtcgtggaggtgatgggccgggagtgcggctatctggcggtcatctct
gcgatgggatcgggggccgaagtctgtgtgatcccggaagtggctttcaaccgtcccgtg
gccgaagcgcgcctcaaaagggagatcgccaacggccgtaactacattctggccatcgtt
gccgaggggacgaagaagactcaggagatcgccgagtggatcgagaaagatctgggattc
gagactcgcgtgacagtactcgggcatatccagaggggaggggccccgagcagttacgac
cgcttgatggctttcgaatttgccgttcgcgcagtcgatcacctactggagagtcaacga
tccaataaagtggtggtctatcaaaacggtcatttcgatctcctggagatcgatacggtc
gtcagtaacaaatatcaactcaatccccggcatttggcaatgctgaatatattggattga

DBGET integrated database retrieval system