KEGG   Nitratifractor salsuginis: Nitsa_1078Help
Entry
Nitsa_1078        CDS       T01405                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nsa  Nitratifractor salsuginis
Pathway
nsa00260  Glycine, serine and threonine metabolism
nsa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nsa01100  Metabolic pathways
nsa01110  Biosynthesis of secondary metabolites
nsa01130  Biosynthesis of antibiotics
nsa01230  Biosynthesis of amino acids
Module
nsa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nitsa_1078
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nitsa_1078
Enzymes [BR:nsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Nitsa_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DFP
Motif
Other DBs
NCBI-ProteinID: ADV46334
UniProt: E6WXS7
Position
complement(1089932..1091164)
Genome map
AA seq 410 aa AA seqDB search
MKHQYLKHQPDEEGYFGEYGGSFLPPQLVEEFDRITEAYMKLRKSHDFLSELRRIRKHYQ
GRPTPVYHAKRLSDAVGGAQLYFKREDLNHTGAHKLNHCMAEALLAKYMGKTKLIAETGA
GQHGVALATAAAYFGLECEIHMGEVDIAKEHPNVVRMQILGAQVVPATHGLRTLKEAVDS
AFESYVKQLDSALYAIGSVVGPHPFPLMVRDFQSVVGIEAREQYMEMTDGELPDHVVACV
GGGSNAMGIFSGFIDDPVELYAVEPLGKSTRLGDHAATLEYGKAGVLHGFKSILLQDEKG
EPAPVHSVASGLDYPGVGPEQAYLHGIGRVHVAGATDEETIDAFYAISQYEGIIPALESA
HAIAYAMKLARKHPNDAILVNLSGRGDKDIDYVVETFGVREWSPEKLNNE
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaccagtatctcaaacaccagcccgatgaagagggatattttggagaatacggc
ggatcctttctcccgccgcagctcgtggaagagttcgaccgcatcaccgaagcctatatg
aaattgagaaagtcccacgattttctcagcgaactgcgccgcatccgcaagcactaccag
gggcgccccactccggtctatcacgccaaacggctcagtgacgccgtgggaggcgcccag
ctctacttcaaacgggaagatctcaaccacaccggcgcccacaagctcaaccactgtatg
gccgaagccctcctggccaaatatatgggcaagaccaagctcatcgccgaaacgggtgcg
gggcagcacggggtcgccctggcgacggcggccgcctatttcggcctggagtgtgagatt
catatgggagaggtggacatcgccaaagagcaccccaacgtggtgcgtatgcagatccta
ggtgctcaggtggtgcctgctacccacgggctgcgcaccctcaaagaggcggtggattcg
gccttcgaatcctatgtcaagcagctcgatagcgccctctacgccatcggttcggtcgtc
ggcccccaccccttccccctgatggtgcgggattttcagagcgtagtcgggatcgaagcg
cgggagcagtatatggagatgaccgacggggagctgcccgatcacgtggtggcctgcgtg
gggggaggctccaacgcgatggggatcttcagcggattcatcgacgatccggtagagctc
tacgccgtggagcctctgggcaagagcacccgcctgggagaccacgccgctacgctggaa
tacggcaaagccggagtgctgcacggattcaaatcgatcctgctccaggatgagaaggga
gagcccgcccccgttcattctgtcgccagcgggctcgattatccgggggtgggcccggag
caggcctatctccacggcatcggtcgggtccacgtggccggagccaccgacgaggagacc
atcgacgccttctacgccatcagccaatacgaggggatcatccccgccctggagagcgcg
cacgccatcgcctacgcgatgaagctggcccgcaaacaccccaacgacgccatcctggtc
aacctctcaggccggggcgacaaagacatcgactatgtggtggagaccttcggtgtgcgg
gagtggtcgccggaaaaactgaataatgagtaa

DBGET integrated database retrieval system