KEGG   Nitratifractor salsuginis: Nitsa_1326Help
Entry
Nitsa_1326        CDS       T01405                                 

Definition
chorismate mutase, type II
Orthology
K04782  
isochorismate pyruvate lyase [EC:4.2.99.21]
Organism
nsa  Nitratifractor salsuginis
Pathway
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Biosynthesis of siderophore group nonribosomal peptides
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1327897..1328196)
Genome map
AA seq 99 aa AA seqDB search
MEIKECSSLEEARKEIDKLDDQIVELIAARNAYIRQLAHFKDSVDEIKAEDRIADVINHV
RSKAIELDLSPNLINDLYLRMIDAMVDTEVAEFKNAKNF
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggagatcaaagagtgcagttctctcgaagaggcccgcaaagagatcgacaagctcgac
gatcagatcgtggagctcatcgctgcgcgtaacgcgtacatccgtcaactggcccacttc
aaggattcggtggatgagatcaaagccgaagaccggatcgccgacgtaatcaaccatgtc
cgatccaaagccatcgaactggatctctcgcccaatctcatcaacgacctctatctgcgg
atgatcgatgcgatggtcgatacggaagtggccgagttcaaaaacgccaaaaatttttaa

DBGET integrated database retrieval system