KEGG   Nitratifractor salsuginis: Nitsa_1326Help
Entry
Nitsa_1326        CDS       T01405                                 

Definition
chorismate mutase, type II
Orthology
K04782  
isochorismate pyruvate lyase [EC:4.2.99.21]
Organism
nsa  Nitratifractor salsuginis
Pathway
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    Nitsa_1326
Enzymes [BR:nsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.21  isochorismate lyase
     Nitsa_1326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1327897..1328196)
Genome map
AA seq 99 aa AA seqDB search
MEIKECSSLEEARKEIDKLDDQIVELIAARNAYIRQLAHFKDSVDEIKAEDRIADVINHV
RSKAIELDLSPNLINDLYLRMIDAMVDTEVAEFKNAKNF
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggagatcaaagagtgcagttctctcgaagaggcccgcaaagagatcgacaagctcgac
gatcagatcgtggagctcatcgctgcgcgtaacgcgtacatccgtcaactggcccacttc
aaggattcggtggatgagatcaaagccgaagaccggatcgccgacgtaatcaaccatgtc
cgatccaaagccatcgaactggatctctcgcccaatctcatcaacgacctctatctgcgg
atgatcgatgcgatggtcgatacggaagtggccgagttcaaaaacgccaaaaatttttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system