KEGG   Nitratifractor salsuginis: Nitsa_1346Help
Entry
Nitsa_1346        CDS       T01405                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
nsa  Nitratifractor salsuginis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nsa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1345978..1346538)
Genome map
AA seq 186 aa AA seqDB search
MAVLRKRIGPGLTLLRTELFPCRLPAQTLRRGEREAWIGIGGNLGDVPRRFEHLRHALAR
SSGIRVLECSPILINPPFGYLEQPDFYNAVLRIATTLSPMELLRRLQGIERRFGRVRTFK
DAPRTLDLDILFYGEQRVDLPDLQIPHPHWQDRDSVRLPLSWMRSRLPLRAIRKLKRRRG
EADTAP
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggcggttctgcgcaagagaatcggccccgggctgacccttttgcgcaccgagcttttt
ccctgccgcctcccggcccaaacgctccgccgcggtgaacgggaagcctggatcgggatc
ggggggaacctgggggatgtgccgcggcgtttcgagcatctccggcatgccctggcccgc
tcgtccgggatcagggtgctggagtgttctccgattctgatcaatccccccttcggatac
ctggaacaacccgatttttacaatgcggtgctgcgcatcgccacgacgctgagcccgatg
gagcttctgcggcggcttcaggggatcgaacgccgtttcggacgtgtccgaactttcaag
gatgcgccgaggaccctggacctggatatcctcttttacggggagcaacgggtcgacctt
cccgatcttcagatcccccacccacactggcaggatcgggattcggtgcgcttgccgcta
agctggatgagaagcaggctccccctgcgagcgatcaggaagctgaaaaggagaagaggc
gaggccgatacggccccctag

DBGET integrated database retrieval system