KEGG   Nitratifractor salsuginis: Nitsa_1375Help
Entry
Nitsa_1375        CDS       T01405                                 

Definition
4-diphosphocytidyl-2c-methyl-d-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nsa  Nitratifractor salsuginis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:nsa00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1375984..1376763
Genome map
AA seq 259 aa AA seqDB search
MTSIDAHAKVNIFLKITGYREGYHTILSRFMRVENLYDTLYFVPAECDTFTIEGCPEVPR
ESNTIYRAWKALNEATGDLDLLEYFYHHKVVVEKRIPSQAGLGGGSSDAGAFLRLTHRVC
DLRISLEELARIGASVGADVPFFVHDYPSANVSGFGEIVEPFDEAPLPLEIYTPPVACDT
AAVYRTFKEHFLSGIDPASFSSWEKLPSKGLLERIDDPALLNDLYPAALLTCPRLKEHAR
EGWFFSGSGSSFFRLAKKS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagtatcgacgcccacgccaaagtcaacatcttcctcaaaatcaccggataccga
gagggctatcacaccatcctctcccgttttatgcgcgtagagaatctttacgataccctc
tacttcgttcctgccgagtgcgacacgtttactatcgaaggatgccccgaggtcccgaga
gaatccaataccatctaccgggcctggaaagccctcaacgaagcgaccggggacctcgat
ctactggaatatttttatcatcataaagtggtcgtagaaaaacgcatcccctcccaggcg
ggtctgggaggcggcagctccgatgccggcgcctttttacgcctgacccatcgggtctgc
gatctcagaatctccctggaggagctggcccggatcggggcgagcgtgggggccgatgtc
ccttttttcgtccacgactatcccagcgccaatgtctcaggtttcggcgaaatcgtcgag
cctttcgacgaagccccccttcccctggagatttacaccccgcctgtcgcctgcgacact
gcggcagtctatcgaaccttcaaagagcacttcctttccggaatcgatccggcatccttc
tccagctgggaaaagctcccctccaaaggacttttggagcggatcgacgatcccgccctg
ctcaacgacctctatcccgccgccctgctgacttgccccaggctcaaagagcatgccagg
gagggatggttcttcagcggtagcggaagtagctttttcaggcttgcaaagaagtcctaa

DBGET integrated database retrieval system