KEGG   Nitratifractor salsuginis: Nitsa_1375Help
Entry
Nitsa_1375        CDS       T01405                                 

Definition
4-diphosphocytidyl-2c-methyl-d-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nsa  Nitratifractor salsuginis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Nitsa_1375
Enzymes [BR:nsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Nitsa_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1375984..1376763
Genome map
AA seq 259 aa AA seqDB search
MTSIDAHAKVNIFLKITGYREGYHTILSRFMRVENLYDTLYFVPAECDTFTIEGCPEVPR
ESNTIYRAWKALNEATGDLDLLEYFYHHKVVVEKRIPSQAGLGGGSSDAGAFLRLTHRVC
DLRISLEELARIGASVGADVPFFVHDYPSANVSGFGEIVEPFDEAPLPLEIYTPPVACDT
AAVYRTFKEHFLSGIDPASFSSWEKLPSKGLLERIDDPALLNDLYPAALLTCPRLKEHAR
EGWFFSGSGSSFFRLAKKS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagtatcgacgcccacgccaaagtcaacatcttcctcaaaatcaccggataccga
gagggctatcacaccatcctctcccgttttatgcgcgtagagaatctttacgataccctc
tacttcgttcctgccgagtgcgacacgtttactatcgaaggatgccccgaggtcccgaga
gaatccaataccatctaccgggcctggaaagccctcaacgaagcgaccggggacctcgat
ctactggaatatttttatcatcataaagtggtcgtagaaaaacgcatcccctcccaggcg
ggtctgggaggcggcagctccgatgccggcgcctttttacgcctgacccatcgggtctgc
gatctcagaatctccctggaggagctggcccggatcggggcgagcgtgggggccgatgtc
ccttttttcgtccacgactatcccagcgccaatgtctcaggtttcggcgaaatcgtcgag
cctttcgacgaagccccccttcccctggagatttacaccccgcctgtcgcctgcgacact
gcggcagtctatcgaaccttcaaagagcacttcctttccggaatcgatccggcatccttc
tccagctgggaaaagctcccctccaaaggacttttggagcggatcgacgatcccgccctg
ctcaacgacctctatcccgccgccctgctgacttgccccaggctcaaagagcatgccagg
gagggatggttcttcagcggtagcggaagtagctttttcaggcttgcaaagaagtcctaa

DBGET integrated database retrieval system