KEGG   Nitratifractor salsuginis: Nitsa_1556Help
Entry
Nitsa_1556        CDS       T01405                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
nsa  Nitratifractor salsuginis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1554973..1556043
Genome map
AA seq 356 aa AA seqDB search
MKALLISLAIFAGIFSLPSFFPEKPLKVPSDEVLRQEALESGYRPIPKTRAGLMREVNGT
YNPMTPAKIALGKKLFFDPILSRDRTVSCASCHILAEGGDDNRPAAIGYHGRINPHHLNS
PTVLNAALEKYEFWDGRVHTVEEQAGGPIQAPFEMNLTPKEAVARLKKDPQYRQTFAKVF
GKEGVTFHNIRMAIGAYERTLLTRGAFDEFLEGNTGALSPAAKRGLTLFMHKGCKGCHSG
MSVGGQFVKRFPLRAYLSDYLGFEFTPKFHMKSSEFPFDNVGDFHGRGGRDFFRVPVLRN
IARTSPYFHNGAVKDLHEAVRIMSKYQIGHEFNKKQIEDVVAFLKSLSGKIVDYGY
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctttgctgatctctttggccatctttgccggaatcttttccctcccctccttt
ttcccggaaaaaccgctcaaagtcccttccgacgaagtcctgcgccaagaagcgctcgaa
agcggctatcgccccatccccaaaacccgtgcgggcctgatgcgggaggtcaacggcacc
tacaacccgatgacccccgccaagatcgccctggggaaaaagctcttcttcgaccccatc
ctctcccgagaccgcaccgtcagctgcgccagttgccacattctcgccgaagggggcgat
gataaccgcccggcggccatcggctatcacggccgcatcaacccccaccacctcaactct
cccacagtgctcaacgccgctttggagaaatatgagttctgggacggaagggtccacacc
gtcgaggagcaggcgggcggcccgatccaagcgccttttgagatgaacctcacccccaaa
gaggcggtagcgcggctcaaaaaggatccccaataccgccaaacctttgccaaggttttc
ggcaaagagggggtcactttccataatatccgtatggccatcggagcctatgagcgaacc
ttgctgacccgaggcgccttcgacgaattcctcgaaggcaacaccggcgccctctccccg
gcagccaaacgggggctgaccctctttatgcacaaaggatgcaaagggtgccacagcggg
atgagcgtcggggggcaattcgtcaaacgctttccccttcgcgcctacctcagcgattat
ctcggctttgagttcacacccaaattccatatgaaaagcagtgaattccccttcgacaat
gtcggagatttccacggacggggcggcagggatttcttccgggttccggtgctgcgcaac
atcgccaggacctccccctacttccacaacggcgccgtcaaggatctgcacgaagcggtg
cggatcatgagtaaataccagatcggccacgaattcaacaaaaagcagatcgaagatgtc
gtcgcctttttgaaatccctcagcgggaaaatcgtggactacgggtattga

DBGET integrated database retrieval system