KEGG   Nitratifractor salsuginis: Nitsa_1747Help
Entry
Nitsa_1747        CDS       T01405                                 

Definition
(GenBank) thiamine pyrophosphate TPP-binding domain-containing protein
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
nsa  Nitratifractor salsuginis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nitsa_1747
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nitsa_1747
   00020 Citrate cycle (TCA cycle)
    Nitsa_1747
   00620 Pyruvate metabolism
    Nitsa_1747
   00640 Propanoate metabolism
    Nitsa_1747
   00650 Butanoate metabolism
    Nitsa_1747
  Energy metabolism
   00680 Methane metabolism
    Nitsa_1747
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Nitsa_1747
Enzymes [BR:nsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Nitsa_1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1749582..1750535)
Genome map
AA seq 317 aa AA seqDB search
MALQSIKNLKEFSTANERFEGAHLLCPGCAHSMIVRELMNATDDNLVIASATGCLEVCTA
VYPYTSWDTSWIHIGFENAASAASGAEAMYKARKRKGTLKDPDAPVKFVAFGGDGATYDI
GFQWLSGAVERGHDFTYICLDNENYANTGGQRSSSTPIGAHTSTAQAGRVSYGKKQKKKD
MVAIMAAHGAPYVAQLAPNKWKIMAKGFQKALETEGPCFINTVSACTTEWKFNPKDTIHI
TDLATDTLMFPIYEIINGTELNILYRPKNVIPVEEYLAAQGRYKHLFKPENRHVIDRIQK
EINEKWEYLQRREEAKV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcattgcaatccattaaaaacctgaaagaattttccaccgccaacgagcgcttcgaa
ggagcgcatctcctctgtcccggctgtgcccactcgatgatcgttcgggaactgatgaac
gctaccgacgacaacctggtgatcgcaagcgccaccggatgcctcgaagtctgtacggcg
gtctatccctacacctcctgggatacctcctggatccacatcggattcgagaacgctgcc
tccgccgcttcgggtgccgaagcgatgtacaaggcccgcaagcgcaaagggaccctcaaa
gatcccgatgctcccgtcaagttcgtcgcgtttggcggggacggtgcgacctacgacatc
ggattccagtggctctccggtgcagtcgagcgtggccatgactttacctacatttgcctc
gacaatgaaaactatgccaataccggcggccagcgctcctcttcgactccgatcggtgcc
catacgtcgaccgcccaggcgggccgggtcagctacgggaagaagcagaagaaaaaagat
atggtcgccatcatggctgcacacggagccccctatgtcgcccagctggctcccaacaag
tggaagatcatggccaaaggtttccaaaaagccctcgagaccgaagggccctgtttcatc
aacaccgtcagcgcctgtaccaccgagtggaagttcaaccccaaagatacgatccacatc
accgacctggcgaccgacacactgatgttccccatctatgagatcatcaacgggaccgag
ctcaacattctctaccgacccaaaaacgtcatcccggtcgaggagtacctggcggcccag
ggacgctacaagcacctcttcaagccggagaaccggcacgtgatcgatcggatccagaaa
gagatcaatgagaagtgggagtatctgcaacgccgcgaagaagccaaggtataa

DBGET integrated database retrieval system