KEGG   Nitratifractor salsuginis: Nitsa_1920Help
Entry
Nitsa_1920        CDS       T01405                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
nsa  Nitratifractor salsuginis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nsa00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1887314..1888282
Genome map
AA seq 322 aa AA seqDB search
MFTRFRRRRLSPALRDLLQETHLSTDDFIYPLFIRSGEGIRNEVASMPGVYQLSIDEAIR
ECEELKHLGLKAVILFGIPDVKDSVGSDALCEHGIIASALRALKSAHPDLFIITDLCFCE
YTDHGHCGILDPVLETVDNDATLVNLGRQAVIHAKAGADMIAPSGMMDGMITAIREALDG
AGYEHLPIMSYSTKFASAWYGPFRDVAESAPSFGDRRSYQMNPANRREAILESLEDEKEG
ADILMVKPGLAYLDILRDIREASRLPLAVYNVSGEYSMLKMAAKAGVIDYERVMMETLLG
FKRAGADLIISYHAKEAAALLK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgttcacccgattcagacgacgccgtctctcccccgccctgcgggatctgctccaggag
acccatctgagcaccgacgatttcatctaccctctcttcatccgaagcggtgaagggatc
cgcaacgaagtggcttctatgcccggagtgtaccagctgagcatcgatgaagcgatccgg
gagtgcgaagagctcaagcacctcggcctcaaagcggtgatcctcttcggcatccccgac
gtcaaagacagcgtgggctccgacgccctctgcgagcacggcatcatcgccagcgccctc
cgggccctcaagagcgcccatcccgacctcttcatcattaccgatctctgcttctgcgaa
tataccgaccacggccactgcggcatcctcgacccggtcctcgaaaccgtagacaacgat
gcgacgttggtcaacctgggcagacaggcggtgatccacgccaaagccggtgcggatatg
atcgcccccagcggaatgatggacgggatgatcactgccatccgcgaagcactggacgga
gcgggctacgagcatctgcccattatgagctactcgaccaaattcgccagcgcctggtac
ggccccttccgggatgtggccgagagcgctccgagcttcggagaccgacgcagctaccag
atgaaccccgccaaccgccgcgaagcgatcctggagagcctggaagatgagaaagagggc
gccgatatcctgatggtcaagccgggcctggcctatctggacatcctccgtgacattcgc
gaagcgagccgtctgcctctggccgtctacaatgtcagcggcgaatactctatgctcaag
atggccgccaaagccggggtcatcgactatgaacgggtgatgatggagaccctgctcggc
ttcaagcgtgccggagccgacctcatcatcagctaccatgccaaagaggcagcggcacta
ttgaaatag

DBGET integrated database retrieval system