KEGG   Nitratifractor salsuginis: Nitsa_2058Help
Entry
Nitsa_2058        CDS       T01405                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nsa  Nitratifractor salsuginis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nsa00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2031699..2033516)
Genome map
AA seq 605 aa AA seqDB search
MCAIFGILGRYESKEAREAFDRLSHRGPDDSHLILRDEGAWGVHRLAIASAGEAIEQPFE
EGGEVLLFNGEIYNVRALADELGIEGDSESRVLLAAWRRWGAAFVERLRGMYAIAILRPA
EGKVSLFRDPSGKKPLFYLNSRDFFAFASEAKALYTLKPFHLERRHLIQYLGFQSTIAPH
TLDREVKKMEPGEHIEFLFEIQNPKSKIQNSIYDPWLEGPILYRKETSAASAVEEALDEA
VASRIPQKVEWGVLLSGGLDSSLVAALAANHSERPLRAFSVSFSGYDKYDEAHWAEQTVR
HLGAEHRVYPFGKREFFETLEALLPLLDEPLGDPAMVPLFFLLRQAAKEGVRVVLGGEGS
DELFLGYRTYPEYFAVEKARELPYRNWLRHYFRAHYSENKEWEWYKRAWEDTPIFRSTAE
LYTDLQLNRLLRQNVRDGANLEAIRPWLERFEASKRSHSADWYSYLDLKVLLGEVYLVKQ
DRVSMAAGIEARSPFLDRRVIETAFAIDPQLRIDTAPKGILKMVAQRYLPAEIVHRKKKG
LNYPFIEWILEEDGIEVLWRLQERSGLFNEEQLEFLARGADRGKFRQHLFPLYLLAKWLE
SRENG
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgcgatcttcggcattctcggccgctatgaatccaaagaggcgagggaggccttt
gatcgcctgagccatcgtggccccgacgacagccacttgatcctgcgtgacgagggagcc
tggggggtccaccgcctggcgatcgccagtgccggcgaagcgatagagcagccctttgaa
gagggtggggaagttctgcttttcaacggagagatctacaatgtccgcgctctggccgat
gaacttgggatcgaaggcgattcggagagccgggtgctcctggcggcgtggcggcgatgg
ggcgcagcctttgtggagcgacttcgggggatgtatgccatcgccatcctccgccccgct
gaggggaaggtctccctctttcgcgacccgtcgggtaaaaaaccccttttttatctgaat
agccgagattttttcgccttcgccagcgaagccaaggccctctacaccctcaaacccttc
catctcgaacggcggcacctgatccagtacctcggttttcaatcgacaatcgcccctcat
acactggaccgggaagtaaaaaagatggaaccaggcgagcatattgagtttttatttgaa
atccaaaatccaaaatccaaaatccaaaattccatttacgatccctggctggagggcccc
attctttatcggaaggaaacttcggcggcaagcgcggtggaagaggcgcttgatgaggcg
gtggcttcgaggatcccgcaaaaggtggagtggggggtgttgctcagcggagggctcgac
tcttctttggtggcggccttggcggcgaatcatagcgagaggcctctgcgggccttcagc
gtgagtttctccggctacgataaatacgatgaagcgcactgggcggagcaaacggtccgt
catctgggggcggagcatcgggtctaccccttcggcaagcgggagttcttcgagacgctg
gaggcgttactgcccctgctggatgagcccctgggggacccggcgatggtgccgctcttt
ttcctgctgcgccaggcggcaaaagagggggtgagggtggtcctgggaggtgaggggagt
gacgaactcttcctcgggtaccgcacctatccggagtatttcgccgtggagaaggcgaga
gaactcccctaccgcaactggctgcgccactacttccgggcccactattcggagaacaag
gagtgggagtggtacaaaagggcctgggaggatacgcctattttccgctccacggcagag
ctctataccgatttgcagctcaaccgcctcctgcggcagaatgtccgggacggggccaac
ctggaggcgatccgcccctggctggagcgtttcgaagcttcgaaacggagccatagcgcc
gactggtacagctatctggatctgaaggtgctcctgggagaagtctatctggtcaagcag
gaccgggtcagtatggccgccggcatcgaagcccgctccccctttttggaccgccgggtg
atcgaaacggcctttgccatcgacccccagctacgtatcgacaccgcccccaagggaatt
ctcaagatggttgcccaaagatatcttcccgctgagatcgtccatcgcaagaaaaagggg
ctcaactacccctttatcgagtggatcctagaagaagacggcatcgaagttctttggcgc
ttgcaggagagaagcgggctgtttaacgaggagcagctggagtttttggcgaggggggcg
gaccggggaaagttccgtcagcatcttttccccctctatctcctggcgaagtggctggag
agtcgagaaaacgggtga

DBGET integrated database retrieval system