KEGG   Neorickettsia sennetsu: NSE_0245Help
Entry
NSE_0245          CDS       T00329                                 

Definition
hypothetical protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
nse  Neorickettsia sennetsu
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:nse00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:nse00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(207848..209257)
Genome map
AA seq 469 aa AA seqDB search
MLYEQICLEISKGRIKNITSDPQKVGKDFLFYAPSEKEHAHIREAINRGARSILTNQKYE
EECLAQGVNFFVHTQPQQIYHEVCSCMWKKQPAYMCAVTGTSGKRSVGHFFSQVCTLAGK
KAVSLSASNEPTDALGLWQEKDHMILDAADMYSILDDLAGRRIEYCCLAISGAAIESRMI
DSVNLKAAAFSNLLRDDLEQPEDIDKRFQMKVRLLSEVLPEDGIMVLPVASEYTTRIIQH
CPNKKVCTYGRATSDIQLISQLPTQKGQILTMKVLGKEMVIHTNILGKFHGNNLVTAMGL
AISCGIDPSSIEHEQISPLAGYMEFLEEYGEERKIMTDCAQTPSELHDLLLSIKWHFPYN
DVTLVLRCSENYEGKNTLKMAKIAAKMVNRIIFTSDSNGSTLTEKSRRELMSCCPKAIEI
EDRKKAMEYAINNCKPSEIIVMQGVKSSIDKRGVVNDAAAMLKAVVAPQ
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtgctatacgagcaaatttgcctggaaatatcaaaggggagaatcaagaacattacttcg
gatcctcaaaaagttgggaaagatttcctattttatgcaccatcagaaaaggaacacgca
cacatccgggaggcaatcaatcgtggtgcaaggagcatactaacaaatcaaaaatatgaa
gaagaatgcctcgcacaaggagttaatttctttgtacacactcaaccacagcagatatat
catgaggtatgctcttgcatgtggaagaaacaaccagcatacatgtgtgcagtaactggc
acaagtggaaagagaagtgttgggcattttttctctcaagtatgcacactggccggaaaa
aaagccgtttctttaagtgcctcaaatgaaccaacagatgctcttgggttatggcaagag
aaagatcatatgatattagacgcagcagacatgtatagcattcttgacgatctagcaggt
agaagaatcgaatattgttgcttagcaatttcaggtgcagcgattgaaagcaggatgata
gatagtgtcaacttaaaggcggctgctttcagcaatctgctacgcgacgatttagaacaa
cccgaagatatagacaaacgcttccagatgaaggtacgactcctctcagaggtattacct
gaggacggcattatggtactgccagtagctagtgagtatacaacaaggataatacaacac
tgtccaaataaaaaagtttgtacatacggaagagccacaagcgacatacagttgatctct
caattgccaacacaaaaaggacaaatactaacaatgaaagtccttgggaaagaaatggtt
attcatacaaatatactcggaaagttccacgggaataatctggtaaccgcaatgggatta
gctatctcatgcggaatagatccatccagcattgaacatgaacaaatcagcccactagcc
gggtatatggagtttctagaagagtacggagaggagcgcaaaattatgacagattgtgcc
cagaccccgagtgaactgcatgatcttctactttctatcaagtggcattttccatataat
gatgtcacccttgtgctcagatgcagcgagaattatgagggaaagaataccctaaagatg
gccaaaatcgcagcaaaaatggtgaataggataatcttcactagcgatagcaatggtagc
actttaacggagaaaagtcggcgcgaacttatgtcttgctgcccaaaagcaattgaaatt
gaggatagaaaaaaagcgatggaatacgcgataaataactgcaaaccatctgagattatc
gtgatgcaaggagtgaaatcatcaatagacaagcgtggtgttgtaaacgatgcagctgca
atgctaaaagccgtagttgctcctcaataa

DBGET integrated database retrieval system